BLASTX nr result
ID: Coptis23_contig00024094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00024094 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526557.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 ref|XP_002321289.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >ref|XP_002526557.1| conserved hypothetical protein [Ricinus communis] gi|223534118|gb|EEF35835.1| conserved hypothetical protein [Ricinus communis] Length = 122 Score = 63.9 bits (154), Expect = 1e-08 Identities = 26/69 (37%), Positives = 45/69 (65%) Frame = +1 Query: 4 WERRLTGEGNVVSLGRVQQKKAINWWDGLAAVQQLLWRFNSQWRRFGKSNRNSIRFSYDL 183 W +R+ + ++LG V+ + + GL ++QLLW+F +QW++ RNS+++SYD+ Sbjct: 40 WGKRIATTESAITLGNVRNRVPFSCCCGLRVLRQLLWKFRTQWKQALGWRRNSVKYSYDI 99 Query: 184 YSYCQNFDD 210 +SY NFDD Sbjct: 100 HSYSLNFDD 108 >ref|XP_002321289.1| predicted protein [Populus trichocarpa] gi|222862062|gb|EEE99604.1| predicted protein [Populus trichocarpa] Length = 93 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/69 (37%), Positives = 41/69 (59%) Frame = +1 Query: 4 WERRLTGEGNVVSLGRVQQKKAINWWDGLAAVQQLLWRFNSQWRRFGKSNRNSIRFSYDL 183 W R + G+ V+L V+++ G + + QL W+F +QW++ + R+S + SYDL Sbjct: 21 WRSRNSSTGSAVTLVSVKRRLPFCRHGGSSFLMQLFWKFRTQWKQAFRWQRSSAQCSYDL 80 Query: 184 YSYCQNFDD 210 YSY NFDD Sbjct: 81 YSYSLNFDD 89