BLASTX nr result
ID: Coptis23_contig00024089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00024089 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310039.1| predicted protein [Populus trichocarpa] gi|2... 93 3e-17 ref|XP_002279193.1| PREDICTED: putative pentatricopeptide repeat... 92 3e-17 ref|XP_002515231.1| pentatricopeptide repeat-containing protein,... 91 7e-17 ref|XP_003536858.1| PREDICTED: putative pentatricopeptide repeat... 87 1e-15 ref|XP_003518677.1| PREDICTED: putative pentatricopeptide repeat... 87 1e-15 >ref|XP_002310039.1| predicted protein [Populus trichocarpa] gi|222852942|gb|EEE90489.1| predicted protein [Populus trichocarpa] Length = 507 Score = 92.8 bits (229), Expect = 3e-17 Identities = 47/69 (68%), Positives = 57/69 (82%), Gaps = 1/69 (1%) Frame = +2 Query: 2 GKLEEAENCFLQMVEKGHKPSNVSFRRIKVLMELANRHEALKILSKKMGIFGPIVQERDR 181 GKL EAE CFLQMVEKGHKPSNVSFRRIKVLMELAN+H+A++ LS+KM IFG ++ + Sbjct: 435 GKLVEAEKCFLQMVEKGHKPSNVSFRRIKVLMELANKHDAIRNLSEKMAIFGSSIRAPEG 494 Query: 182 I-EREAS*P 205 + E+E S P Sbjct: 495 MDEKECSDP 503 >ref|XP_002279193.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Vitis vinifera] Length = 526 Score = 92.4 bits (228), Expect = 3e-17 Identities = 44/62 (70%), Positives = 52/62 (83%) Frame = +2 Query: 2 GKLEEAENCFLQMVEKGHKPSNVSFRRIKVLMELANRHEALKILSKKMGIFGPIVQERDR 181 GKL E E C LQM+EKGHKPSNVSFRRIKVLMELAN+HEAL+ L++KM +FGP Q ++R Sbjct: 452 GKLVEVEKCCLQMIEKGHKPSNVSFRRIKVLMELANKHEALQNLTEKMAMFGPSTQVQER 511 Query: 182 IE 187 E Sbjct: 512 AE 513 >ref|XP_002515231.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545711|gb|EEF47215.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 505 Score = 91.3 bits (225), Expect = 7e-17 Identities = 45/62 (72%), Positives = 50/62 (80%) Frame = +2 Query: 2 GKLEEAENCFLQMVEKGHKPSNVSFRRIKVLMELANRHEALKILSKKMGIFGPIVQERDR 181 GKL EAE CFLQM+EKGHKPSNVSFRRIKVLMEL N+H+AL L KKM IFG +Q +R Sbjct: 431 GKLVEAEKCFLQMIEKGHKPSNVSFRRIKVLMELVNKHDALLNLQKKMAIFGSSIQLPER 490 Query: 182 IE 187 E Sbjct: 491 EE 492 >ref|XP_003536858.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Glycine max] Length = 279 Score = 87.4 bits (215), Expect = 1e-15 Identities = 44/58 (75%), Positives = 50/58 (86%) Frame = +2 Query: 2 GKLEEAENCFLQMVEKGHKPSNVSFRRIKVLMELANRHEALKILSKKMGIFGPIVQER 175 GKLEEAE CFL+MVEKG KPS+VSFRRIKVLMELANRHEAL+ L++KM IF +Q R Sbjct: 222 GKLEEAEKCFLEMVEKGQKPSHVSFRRIKVLMELANRHEALQSLTQKMAIFRRPLQVR 279 >ref|XP_003518677.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Glycine max] Length = 500 Score = 87.4 bits (215), Expect = 1e-15 Identities = 43/56 (76%), Positives = 49/56 (87%) Frame = +2 Query: 2 GKLEEAENCFLQMVEKGHKPSNVSFRRIKVLMELANRHEALKILSKKMGIFGPIVQ 169 GKLEEAE CFL+MVEKG KPS+VSFRRIKVLMELANRHEAL+ L +KM +FG +Q Sbjct: 426 GKLEEAEKCFLEMVEKGQKPSHVSFRRIKVLMELANRHEALQSLMQKMAMFGRPLQ 481