BLASTX nr result
ID: Coptis23_contig00023559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00023559 (223 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282438.1| PREDICTED: uncharacterized protein LOC100267... 90 2e-16 ref|XP_002525886.1| small heat-shock protein, putative [Ricinus ... 85 7e-15 gb|ADU55782.1| HSP27.8 [Citrullus lanatus] 81 1e-13 dbj|BAJ33960.1| unnamed protein product [Thellungiella halophila] 80 1e-13 ref|XP_002892343.1| predicted protein [Arabidopsis lyrata subsp.... 80 2e-13 >ref|XP_002282438.1| PREDICTED: uncharacterized protein LOC100267696 [Vitis vinifera] gi|302143482|emb|CBI22043.3| unnamed protein product [Vitis vinifera] Length = 259 Score = 90.1 bits (222), Expect = 2e-16 Identities = 37/66 (56%), Positives = 50/66 (75%) Frame = +3 Query: 3 LVVTGKRSTEWWRAPNASKDSILTYHKSGVVQGPYEIVWPLPSNVNKDLVSAEFVSGVLR 182 L+V GKRST+WW+ + S DSI YHK ++QGPY++ W LP N NKD VSA+FV G L+ Sbjct: 194 LIVMGKRSTQWWKVASCSNDSIPAYHKREILQGPYQVAWTLPFNANKDRVSAQFVDGFLQ 253 Query: 183 ISLPKI 200 I++PK+ Sbjct: 254 ITIPKL 259 >ref|XP_002525886.1| small heat-shock protein, putative [Ricinus communis] gi|223534800|gb|EEF36490.1| small heat-shock protein, putative [Ricinus communis] Length = 249 Score = 84.7 bits (208), Expect = 7e-15 Identities = 37/66 (56%), Positives = 49/66 (74%) Frame = +3 Query: 3 LVVTGKRSTEWWRAPNASKDSILTYHKSGVVQGPYEIVWPLPSNVNKDLVSAEFVSGVLR 182 L + GKRST+ W S DSI YHK ++QGPY++VWPLPSN+NKD +SAEF+ G+L Sbjct: 189 LTIMGKRSTQSW-----SNDSISAYHKREILQGPYQVVWPLPSNINKDRISAEFLDGILE 243 Query: 183 ISLPKI 200 I +PK+ Sbjct: 244 IIIPKV 249 >gb|ADU55782.1| HSP27.8 [Citrullus lanatus] Length = 254 Score = 80.9 bits (198), Expect = 1e-13 Identities = 36/66 (54%), Positives = 48/66 (72%) Frame = +3 Query: 3 LVVTGKRSTEWWRAPNASKDSILTYHKSGVVQGPYEIVWPLPSNVNKDLVSAEFVSGVLR 182 L + GKRS ++ S DSI +YHK ++QGPY++VWPLP N+NKD V AEF G+LR Sbjct: 189 LTIIGKRSNQYCEVVGYSSDSISSYHKREILQGPYQVVWPLPININKDGVFAEFWDGLLR 248 Query: 183 ISLPKI 200 I+LPK+ Sbjct: 249 ITLPKL 254 >dbj|BAJ33960.1| unnamed protein product [Thellungiella halophila] Length = 292 Score = 80.5 bits (197), Expect = 1e-13 Identities = 35/66 (53%), Positives = 50/66 (75%) Frame = +3 Query: 3 LVVTGKRSTEWWRAPNASKDSILTYHKSGVVQGPYEIVWPLPSNVNKDLVSAEFVSGVLR 182 L VTG+R++ + +KDS+ YHK ++QGP+++ WPLPSNVNKD VSAEF+ G+LR Sbjct: 227 LTVTGRRTSICQKVDACTKDSVFGYHKQEILQGPFKVSWPLPSNVNKDNVSAEFMDGLLR 286 Query: 183 ISLPKI 200 I +PK+ Sbjct: 287 IVIPKL 292 >ref|XP_002892343.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297338185|gb|EFH68602.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 284 Score = 80.1 bits (196), Expect = 2e-13 Identities = 36/66 (54%), Positives = 50/66 (75%) Frame = +3 Query: 3 LVVTGKRSTEWWRAPNASKDSILTYHKSGVVQGPYEIVWPLPSNVNKDLVSAEFVSGVLR 182 L VTG+R++ + +K SIL YHK ++QGP+++ WPLPSNVNKD VSAEF+ G+LR Sbjct: 219 LTVTGRRTSICQKVDAGTKASILGYHKQEILQGPFKVSWPLPSNVNKDNVSAEFMDGILR 278 Query: 183 ISLPKI 200 I +PK+ Sbjct: 279 IVIPKL 284