BLASTX nr result
ID: Coptis23_contig00023269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00023269 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63193.1| gag-pol polyprotein, putative [Asparagus officina... 50 5e-06 >gb|ABD63193.1| gag-pol polyprotein, putative [Asparagus officinalis] Length = 358 Score = 50.4 bits (119), Expect(2) = 5e-06 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 2/60 (3%) Frame = -3 Query: 220 P*LSQLNELTCDASESVIGCLSE*QTHCI--FSQKISGAKSKSSNSDRELYAIIQAIKHW 47 P S++ E+ CDAS IG + + H I FS K+SGAK S D+E YA++Q+++HW Sbjct: 238 PDFSKVFEVACDASGIGIGGVLSQEKHPIAYFSAKLSGAKLNYSTYDKEFYAVVQSLRHW 297 Score = 24.6 bits (52), Expect(2) = 5e-06 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 306 RSPFSCPHEAAEEDDLAKKKMTTAPTLALPD 214 + F EAA K++MT AP + LPD Sbjct: 209 KEEFRWSEEAATAFKEIKQRMTDAPVMRLPD 239