BLASTX nr result
ID: Coptis23_contig00023267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00023267 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514272.1| nitrate transporter, putative [Ricinus commu... 59 5e-07 ref|XP_004170441.1| PREDICTED: probable peptide transporter At1g... 55 8e-06 ref|XP_004141840.1| PREDICTED: probable peptide transporter At1g... 55 8e-06 >ref|XP_002514272.1| nitrate transporter, putative [Ricinus communis] gi|223546728|gb|EEF48226.1| nitrate transporter, putative [Ricinus communis] Length = 595 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = -1 Query: 239 KCQIPPGSFGIFSIGTLIIWVVIYDHLIIPQLAKIIGKPYGLGLKQ 102 K +IP GSFG+F+I TL IWV IYD +++P++AKI +P GL KQ Sbjct: 363 KAKIPAGSFGVFTILTLTIWVAIYDQVLVPRIAKITKRPRGLTNKQ 408 >ref|XP_004170441.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis sativus] Length = 500 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -1 Query: 233 QIPPGSFGIFSIGTLIIWVVIYDHLIIPQLAKIIGKPYGLGLK 105 QIP GSFG F I T++IWV++YD I+P +KI GKP G+K Sbjct: 262 QIPAGSFGTFVIITIVIWVILYDRAILPLASKIRGKPVHFGVK 304 >ref|XP_004141840.1| PREDICTED: probable peptide transporter At1g52190-like [Cucumis sativus] Length = 608 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -1 Query: 233 QIPPGSFGIFSIGTLIIWVVIYDHLIIPQLAKIIGKPYGLGLK 105 QIP GSFG F I T++IWV++YD I+P +KI GKP G+K Sbjct: 370 QIPAGSFGTFVIITIVIWVILYDRAILPLASKIRGKPVHFGVK 412