BLASTX nr result
ID: Coptis23_contig00023210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00023210 (508 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524180.1| glutamate receptor 3 plant, putative [Ricinu... 55 6e-06 >ref|XP_002524180.1| glutamate receptor 3 plant, putative [Ricinus communis] gi|223536549|gb|EEF38195.1| glutamate receptor 3 plant, putative [Ricinus communis] Length = 921 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/43 (62%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +3 Query: 381 GIITPLFILTWVIM-SHFVYCQRPMVVNIGAVFTYNSVIGRVA 506 G +T LF + WV++ + FV CQRP VNIGAVFT++SVIGRVA Sbjct: 10 GKLTKLFSIIWVLLLNDFVSCQRPKFVNIGAVFTFDSVIGRVA 52