BLASTX nr result
ID: Coptis23_contig00023171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00023171 (859 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532342.1| nucleic acid binding protein, putative [Rici... 79 1e-12 ref|NP_191350.1| D111/G-patch domain-containing protein [Arabido... 77 4e-12 ref|XP_002876444.1| hypothetical protein ARALYDRAFT_486242 [Arab... 77 7e-12 ref|NP_001242303.1| uncharacterized protein LOC100806249 [Glycin... 75 1e-11 ref|XP_003519055.1| PREDICTED: coiled-coil domain-containing pro... 75 2e-11 >ref|XP_002532342.1| nucleic acid binding protein, putative [Ricinus communis] gi|223527959|gb|EEF30044.1| nucleic acid binding protein, putative [Ricinus communis] Length = 257 Score = 79.0 bits (193), Expect = 1e-12 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = +2 Query: 350 QDLHDILVRLREEHHYCLFCGFQYESTEALLSNCPGTDEDDH 475 +DL +IL++LR+EH YCLFCGFQYE+ EALLS+CPGTDEDDH Sbjct: 216 EDLQEILMKLRDEHRYCLFCGFQYETKEALLSDCPGTDEDDH 257 >ref|NP_191350.1| D111/G-patch domain-containing protein [Arabidopsis thaliana] gi|6729534|emb|CAB67619.1| putative protein [Arabidopsis thaliana] gi|46931310|gb|AAT06459.1| At3g57910 [Arabidopsis thaliana] gi|62320600|dbj|BAD95245.1| putative protein [Arabidopsis thaliana] gi|332646195|gb|AEE79716.1| D111/G-patch domain-containing protein [Arabidopsis thaliana] Length = 265 Score = 77.4 bits (189), Expect = 4e-12 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +2 Query: 350 QDLHDILVRLREEHHYCLFCGFQYESTEALLSNCPGTDEDDH 475 +DL +IL++LR EH YCLFCGFQYE+TEALLSNCPG +EDDH Sbjct: 224 EDLQEILMKLRAEHWYCLFCGFQYETTEALLSNCPGVNEDDH 265 >ref|XP_002876444.1| hypothetical protein ARALYDRAFT_486242 [Arabidopsis lyrata subsp. lyrata] gi|297322282|gb|EFH52703.1| hypothetical protein ARALYDRAFT_486242 [Arabidopsis lyrata subsp. lyrata] Length = 265 Score = 76.6 bits (187), Expect = 7e-12 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +2 Query: 350 QDLHDILVRLREEHHYCLFCGFQYESTEALLSNCPGTDEDDH 475 +DL +IL++LR+EH YC FCGFQYE+TEALLSNCPG +EDDH Sbjct: 224 EDLQEILMKLRDEHRYCPFCGFQYETTEALLSNCPGVNEDDH 265 >ref|NP_001242303.1| uncharacterized protein LOC100806249 [Glycine max] gi|255647124|gb|ACU24030.1| unknown [Glycine max] Length = 262 Score = 75.5 bits (184), Expect = 1e-11 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +2 Query: 350 QDLHDILVRLREEHHYCLFCGFQYESTEALLSNCPGTDEDDH 475 +DLHD+L++LR+E +YCLFCG QYES ALL+NCPGT+EDDH Sbjct: 221 EDLHDVLMKLRDEFNYCLFCGCQYESNHALLANCPGTNEDDH 262 >ref|XP_003519055.1| PREDICTED: coiled-coil domain-containing protein 75-like [Glycine max] Length = 269 Score = 74.7 bits (182), Expect = 2e-11 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = +2 Query: 350 QDLHDILVRLREEHHYCLFCGFQYESTEALLSNCPGTDEDDH 475 +DLHD+L++LR+E +YCLFCG QYES++ LL NCPGT+EDDH Sbjct: 228 EDLHDVLMKLRDEFNYCLFCGCQYESSDVLLGNCPGTNEDDH 269