BLASTX nr result
ID: Coptis23_contig00022486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00022486 (215 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||T00833 RNA-directed DNA polymerase homolog T13L16.7 - Arabi... 56 3e-06 >pir||T00833 RNA-directed DNA polymerase homolog T13L16.7 - Arabidopsis thaliana (fragment) Length = 1365 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/65 (35%), Positives = 35/65 (53%) Frame = -2 Query: 196 SFYLQIWKSNGNPRTELFAWKSIHDIFPTRERLNRIFPIKDQRCVFCRTTVETLHHLLME 17 S + +IW + P+ +F WK++H P +RL D C+ C T ET++H+L E Sbjct: 1040 SLFDKIWNLHTAPKIRIFLWKALHGAIPVEDRLRTRGIRSDDGCLMCDTENETINHILFE 1099 Query: 16 CPFTR 2 CP R Sbjct: 1100 CPLAR 1104