BLASTX nr result
ID: Coptis23_contig00022323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00022323 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277025.1| PREDICTED: serine/threonine-protein kinase K... 57 1e-06 >ref|XP_002277025.1| PREDICTED: serine/threonine-protein kinase KIPK-like [Vitis vinifera] Length = 864 Score = 57.4 bits (137), Expect = 1e-06 Identities = 34/75 (45%), Positives = 44/75 (58%) Frame = -1 Query: 227 QKGEMYPAPSSSVTNMGKVIKSAGNSPWVIKPAPRHTKFVERKIKQDSASVPNCSTTYKE 48 +KG + PSSSV N K KS N+ V+KP R+ FV++K+KQDS S + S T E Sbjct: 287 RKGRLQNVPSSSV-NSSKASKSTKNTQRVVKPILRNKNFVKKKVKQDSNSATSTSNTCSE 345 Query: 47 VDNDDFVPVIHNLVC 3 V ND+ P LVC Sbjct: 346 V-NDEMDPSTSQLVC 359