BLASTX nr result
ID: Coptis23_contig00022083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00022083 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004158535.1| PREDICTED: LOW QUALITY PROTEIN: lisH domain ... 70 1e-10 ref|XP_004138804.1| PREDICTED: LOW QUALITY PROTEIN: lisH domain ... 70 1e-10 ref|XP_002528079.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|XP_002281005.1| PREDICTED: lisH domain and HEAT repeat-conta... 66 3e-09 emb|CBI33620.3| unnamed protein product [Vitis vinifera] 66 3e-09 >ref|XP_004158535.1| PREDICTED: LOW QUALITY PROTEIN: lisH domain and HEAT repeat-containing protein KIAA1468 homolog [Cucumis sativus] Length = 1190 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/52 (63%), Positives = 39/52 (75%) Frame = -1 Query: 253 GKRESGDPLPSESVETPKPDLPAPVEDTRFRRIMRGNFGEMLRGKGKGNEDA 98 GK+ES +P PSE VE P P P P EDTRFRRIMRG+F +MLRGK K E++ Sbjct: 1136 GKKESLEPTPSEPVEPPNPTPPPPAEDTRFRRIMRGSFTDMLRGKVKSQEES 1187 >ref|XP_004138804.1| PREDICTED: LOW QUALITY PROTEIN: lisH domain and HEAT repeat-containing protein KIAA1468 homolog [Cucumis sativus] Length = 1249 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/52 (63%), Positives = 39/52 (75%) Frame = -1 Query: 253 GKRESGDPLPSESVETPKPDLPAPVEDTRFRRIMRGNFGEMLRGKGKGNEDA 98 GK+ES +P PSE VE P P P P EDTRFRRIMRG+F +MLRGK K E++ Sbjct: 1195 GKKESLEPTPSEPVEPPNPTPPPPAEDTRFRRIMRGSFTDMLRGKVKSQEES 1246 >ref|XP_002528079.1| conserved hypothetical protein [Ricinus communis] gi|223532540|gb|EEF34329.1| conserved hypothetical protein [Ricinus communis] Length = 1167 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -1 Query: 253 GKRESGDPLPSESVETPKPDLPAPVEDTRFRRIMRGNFGEMLRGKGKGNE 104 GK+E+ DPLP + E+PKP LP EDTRFRRIMRGNF +MLRGK + N+ Sbjct: 1119 GKKEAADPLPQDP-ESPKPVLPPAAEDTRFRRIMRGNFTDMLRGKTQPNQ 1167 >ref|XP_002281005.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468 homolog [Vitis vinifera] Length = 1184 Score = 66.2 bits (160), Expect = 3e-09 Identities = 33/56 (58%), Positives = 38/56 (67%) Frame = -1 Query: 253 GKRESGDPLPSESVETPKPDLPAPVEDTRFRRIMRGNFGEMLRGKGKGNEDAPKEQ 86 GK++SGDP P E VE+P+ P P EDTRF RIMRGNF +MLR K K ED Q Sbjct: 1130 GKKDSGDP-PPEPVESPRAVPPPPAEDTRFMRIMRGNFTDMLRSKAKNQEDTSTGQ 1184 >emb|CBI33620.3| unnamed protein product [Vitis vinifera] Length = 178 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/51 (62%), Positives = 37/51 (72%) Frame = -1 Query: 253 GKRESGDPLPSESVETPKPDLPAPVEDTRFRRIMRGNFGEMLRGKGKGNED 101 GK++SGDP P E VE+P+ P P EDTRF RIMRGNF +MLR K K ED Sbjct: 101 GKKDSGDP-PPEPVESPRAVPPPPAEDTRFMRIMRGNFTDMLRSKAKNQED 150