BLASTX nr result
ID: Coptis23_contig00022082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00022082 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004158535.1| PREDICTED: LOW QUALITY PROTEIN: lisH domain ... 68 7e-10 ref|XP_004138804.1| PREDICTED: LOW QUALITY PROTEIN: lisH domain ... 68 7e-10 ref|XP_002281005.1| PREDICTED: lisH domain and HEAT repeat-conta... 64 1e-08 emb|CBI33620.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002528079.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 >ref|XP_004158535.1| PREDICTED: LOW QUALITY PROTEIN: lisH domain and HEAT repeat-containing protein KIAA1468 homolog [Cucumis sativus] Length = 1190 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = -1 Query: 293 GKRESGDSLPSESVETPKPDSPAPVEDTRFRRIMRGNFGEMLRGKGKGNEDA 138 GK+ES + PSE VE P P P P EDTRFRRIMRG+F +MLRGK K E++ Sbjct: 1136 GKKESLEPTPSEPVEPPNPTPPPPAEDTRFRRIMRGSFTDMLRGKVKSQEES 1187 >ref|XP_004138804.1| PREDICTED: LOW QUALITY PROTEIN: lisH domain and HEAT repeat-containing protein KIAA1468 homolog [Cucumis sativus] Length = 1249 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = -1 Query: 293 GKRESGDSLPSESVETPKPDSPAPVEDTRFRRIMRGNFGEMLRGKGKGNEDA 138 GK+ES + PSE VE P P P P EDTRFRRIMRG+F +MLRGK K E++ Sbjct: 1195 GKKESLEPTPSEPVEPPNPTPPPPAEDTRFRRIMRGSFTDMLRGKVKSQEES 1246 >ref|XP_002281005.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468 homolog [Vitis vinifera] Length = 1184 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/56 (57%), Positives = 37/56 (66%) Frame = -1 Query: 293 GKRESGDSLPSESVETPKPDSPAPVEDTRFRRIMRGNFGEMLRGKGKGNEDAPKEQ 126 GK++SGD P E VE+P+ P P EDTRF RIMRGNF +MLR K K ED Q Sbjct: 1130 GKKDSGDP-PPEPVESPRAVPPPPAEDTRFMRIMRGNFTDMLRSKAKNQEDTSTGQ 1184 >emb|CBI33620.3| unnamed protein product [Vitis vinifera] Length = 178 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/51 (60%), Positives = 36/51 (70%) Frame = -1 Query: 293 GKRESGDSLPSESVETPKPDSPAPVEDTRFRRIMRGNFGEMLRGKGKGNED 141 GK++SGD P E VE+P+ P P EDTRF RIMRGNF +MLR K K ED Sbjct: 101 GKKDSGDP-PPEPVESPRAVPPPPAEDTRFMRIMRGNFTDMLRSKAKNQED 150 >ref|XP_002528079.1| conserved hypothetical protein [Ricinus communis] gi|223532540|gb|EEF34329.1| conserved hypothetical protein [Ricinus communis] Length = 1167 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = -1 Query: 293 GKRESGDSLPSESVETPKPDSPAPVEDTRFRRIMRGNFGEMLRGKGKGNE 144 GK+E+ D LP + E+PKP P EDTRFRRIMRGNF +MLRGK + N+ Sbjct: 1119 GKKEAADPLPQDP-ESPKPVLPPAAEDTRFRRIMRGNFTDMLRGKTQPNQ 1167