BLASTX nr result
ID: Coptis23_contig00021845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00021845 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN81188.1| hypothetical protein VITISV_029907 [Vitis vinifera] 56 3e-06 >emb|CAN81188.1| hypothetical protein VITISV_029907 [Vitis vinifera] Length = 960 Score = 55.8 bits (133), Expect = 3e-06 Identities = 30/49 (61%), Positives = 31/49 (63%) Frame = +3 Query: 66 EANQEKIVEVGGXXXXXXXXXXXEDEMIRRVAAGAIANLAMNGWCNDTL 212 EANQEKIVE GG EDE +RRVAAGAIANLAMN N L Sbjct: 787 EANQEKIVEAGGLSSLLMLLRRFEDETVRRVAAGAIANLAMNAEANQEL 835