BLASTX nr result
ID: Coptis23_contig00021798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00021798 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAZ01854.1| hypothetical protein OsI_23875 [Oryza sativa Indi... 50 1e-06 >gb|EAZ01854.1| hypothetical protein OsI_23875 [Oryza sativa Indica Group] Length = 784 Score = 50.1 bits (118), Expect(2) = 1e-06 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = +2 Query: 107 SYFPFFFCSTVLDVVDSCRTRVATNIILGLALGYKSVI 220 S+ F S V DV DSCRT ATN+I GLALGYKSVI Sbjct: 441 SHLEFPLSSPVQDVADSCRTGAATNVIFGLALGYKSVI 478 Score = 26.9 bits (58), Expect(2) = 1e-06 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +1 Query: 1 VIGFVIEYSTSNAY 42 +IGFV EY TSNAY Sbjct: 422 IIGFVTEYYTSNAY 435