BLASTX nr result
ID: Coptis23_contig00021797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00021797 (892 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002882864.1| hypothetical protein ARALYDRAFT_478803 [Arab... 70 7e-10 ref|XP_002509650.1| conserved hypothetical protein [Ricinus comm... 70 7e-10 ref|XP_002521932.1| conserved hypothetical protein [Ricinus comm... 69 1e-09 dbj|BAB02326.1| unnamed protein product [Arabidopsis thaliana] 69 2e-09 dbj|BAH30450.1| hypothetical protein [Arabidopsis thaliana] 69 2e-09 >ref|XP_002882864.1| hypothetical protein ARALYDRAFT_478803 [Arabidopsis lyrata subsp. lyrata] gi|297328704|gb|EFH59123.1| hypothetical protein ARALYDRAFT_478803 [Arabidopsis lyrata subsp. lyrata] Length = 398 Score = 70.1 bits (170), Expect = 7e-10 Identities = 28/59 (47%), Positives = 41/59 (69%) Frame = -3 Query: 704 RCRRTDGKSWRCTKDCAPDQKYCEKHMYRGKARTDQKTNRGKTRKKQVKSTNQATSSNN 528 RCRRTDGK WRC+++ PD KYCEKHM+RG+ R + ++ +TR + S + + +NN Sbjct: 86 RCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLDQNQTRTTPLTSPSLSFHNNN 144 >ref|XP_002509650.1| conserved hypothetical protein [Ricinus communis] gi|223549549|gb|EEF51037.1| conserved hypothetical protein [Ricinus communis] Length = 233 Score = 70.1 bits (170), Expect = 7e-10 Identities = 30/58 (51%), Positives = 42/58 (72%) Frame = -3 Query: 704 RCRRTDGKSWRCTKDCAPDQKYCEKHMYRGKARTDQKTNRGKTRKKQVKSTNQATSSN 531 RCRRTDGK WRC+K+ PDQKYCE+HM+RG+ Q++ + Q K+++ ATS+N Sbjct: 145 RCRRTDGKKWRCSKEALPDQKYCERHMHRGR----QRSRKLVEAASQTKTSDTATSTN 198 >ref|XP_002521932.1| conserved hypothetical protein [Ricinus communis] gi|223538857|gb|EEF40456.1| conserved hypothetical protein [Ricinus communis] Length = 479 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/61 (49%), Positives = 40/61 (65%), Gaps = 4/61 (6%) Frame = -3 Query: 704 RCRRTDGKSWRCTKDCAPDQKYCEKHMYRGKART----DQKTNRGKTRKKQVKSTNQATS 537 RCRRTDGK WRC++D APDQKYCE+HM+RG+ R+ + N +K + N T+ Sbjct: 149 RCRRTDGKKWRCSRDAAPDQKYCERHMHRGRPRSRKPVELLANTNNNKKIRYNYVNNHTN 208 Query: 536 S 534 S Sbjct: 209 S 209 >dbj|BAB02326.1| unnamed protein product [Arabidopsis thaliana] Length = 397 Score = 68.6 bits (166), Expect = 2e-09 Identities = 27/59 (45%), Positives = 41/59 (69%) Frame = -3 Query: 704 RCRRTDGKSWRCTKDCAPDQKYCEKHMYRGKARTDQKTNRGKTRKKQVKSTNQATSSNN 528 RCRRTDGK WRC+++ PD KYCEKHM+RG+ R + ++ +T + S + + ++NN Sbjct: 86 RCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLDQNQTTTTPLTSPSLSFTNNN 144 >dbj|BAH30450.1| hypothetical protein [Arabidopsis thaliana] Length = 396 Score = 68.6 bits (166), Expect = 2e-09 Identities = 27/59 (45%), Positives = 41/59 (69%) Frame = -3 Query: 704 RCRRTDGKSWRCTKDCAPDQKYCEKHMYRGKARTDQKTNRGKTRKKQVKSTNQATSSNN 528 RCRRTDGK WRC+++ PD KYCEKHM+RG+ R + ++ +T + S + + ++NN Sbjct: 85 RCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLDQNQTTTTPLTSPSLSFTNNN 143