BLASTX nr result
ID: Coptis23_contig00021767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00021767 (607 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35712.3| unnamed protein product [Vitis vinifera] 68 1e-09 >emb|CBI35712.3| unnamed protein product [Vitis vinifera] Length = 412 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/62 (54%), Positives = 41/62 (66%), Gaps = 4/62 (6%) Frame = +1 Query: 238 LSIFCCK----KAMLGYLSHCAANGREPTTVYVQEGINAPVCWILFVFN*HLLPCFGSLT 405 LS+ CC+ +AMLGY+SHCA +GR YVQ G NAP+ WILF FN LLP FG L Sbjct: 50 LSLHCCQVPLSQAMLGYMSHCATHGRGHRRYYVQPGTNAPISWILFAFNRQLLP-FGELP 108 Query: 406 NI 411 + Sbjct: 109 GV 110