BLASTX nr result
ID: Coptis23_contig00021612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00021612 (380 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003516824.1| PREDICTED: monoglyceride lipase-like [Glycin... 60 1e-07 ref|XP_002887682.1| hypothetical protein ARALYDRAFT_476907 [Arab... 59 4e-07 ref|XP_003536681.1| PREDICTED: monoglyceride lipase-like [Glycin... 58 7e-07 ref|NP_177867.1| alpha/beta-hydrolase-like protein [Arabidopsis ... 57 1e-06 ref|XP_003614638.1| Monoglyceride lipase [Medicago truncatula] g... 57 1e-06 >ref|XP_003516824.1| PREDICTED: monoglyceride lipase-like [Glycine max] Length = 394 Score = 60.5 bits (145), Expect = 1e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 93 APLGIRTMKWYERNSKGLEIFCKSWLPKKGV 1 AP GIRT +WYERNS+GLEIFCKSW+PK G+ Sbjct: 99 APAGIRTEEWYERNSRGLEIFCKSWMPKPGI 129 >ref|XP_002887682.1| hypothetical protein ARALYDRAFT_476907 [Arabidopsis lyrata subsp. lyrata] gi|297333523|gb|EFH63941.1| hypothetical protein ARALYDRAFT_476907 [Arabidopsis lyrata subsp. lyrata] Length = 379 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 93 APLGIRTMKWYERNSKGLEIFCKSWLPKKG 4 AP+GIRT +WYERNSKG +IFCKSWLPK G Sbjct: 84 APIGIRTEEWYERNSKGEQIFCKSWLPKSG 113 >ref|XP_003536681.1| PREDICTED: monoglyceride lipase-like [Glycine max] Length = 383 Score = 58.2 bits (139), Expect = 7e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 93 APLGIRTMKWYERNSKGLEIFCKSWLPKKGV 1 AP GIRT +WYERNS+GLEIFCK+W+P+ GV Sbjct: 89 APAGIRTEEWYERNSRGLEIFCKNWMPEPGV 119 >ref|NP_177867.1| alpha/beta-hydrolase-like protein [Arabidopsis thaliana] gi|11079483|gb|AAG29195.1|AC078898_5 lysophospholipase isolog, putative [Arabidopsis thaliana] gi|12323393|gb|AAG51674.1|AC010704_18 putative lipase; 4162-5963 [Arabidopsis thaliana] gi|26452792|dbj|BAC43476.1| putative lipase [Arabidopsis thaliana] gi|28973023|gb|AAO63836.1| putative lysophospholipase isolog [Arabidopsis thaliana] gi|332197855|gb|AEE35976.1| alpha/beta-hydrolase-like protein [Arabidopsis thaliana] Length = 382 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 93 APLGIRTMKWYERNSKGLEIFCKSWLPKKG 4 AP GIRT +WYERNSKG +IFCKSWLPK G Sbjct: 87 APSGIRTEEWYERNSKGEDIFCKSWLPKSG 116 >ref|XP_003614638.1| Monoglyceride lipase [Medicago truncatula] gi|355515973|gb|AES97596.1| Monoglyceride lipase [Medicago truncatula] Length = 395 Score = 57.4 bits (137), Expect = 1e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -3 Query: 93 APLGIRTMKWYERNSKGLEIFCKSWLPKKGV 1 AP GIR +WYERNS+GLEIFCKSW+P+ G+ Sbjct: 100 APAGIRAEEWYERNSRGLEIFCKSWMPESGI 130