BLASTX nr result
ID: Coptis23_contig00021474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00021474 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610646.1| hypothetical protein MTR_5g005410 [Medicago ... 57 1e-06 >ref|XP_003610646.1| hypothetical protein MTR_5g005410 [Medicago truncatula] gi|355511981|gb|AES93604.1| hypothetical protein MTR_5g005410 [Medicago truncatula] Length = 389 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/56 (51%), Positives = 35/56 (62%) Frame = +3 Query: 66 GLFPSDLSHPQQGVRLLGGAVSTDASFVMGLARKRIDKAMTLMDRLAILEDPQCEL 233 GLFP D+ P GV+LLGG VS D F+ GLA KR + + LM L L DPQ E+ Sbjct: 68 GLFPVDIRRPTLGVKLLGGVVSRDKGFIEGLAIKRASRVVELMHLLPRLRDPQREI 123