BLASTX nr result
ID: Coptis23_contig00021455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00021455 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28862.3| unnamed protein product [Vitis vinifera] 58 9e-07 ref|XP_002274828.1| PREDICTED: glucan endo-1,3-beta-glucosidase ... 58 9e-07 ref|XP_003573030.1| PREDICTED: glucan endo-1,3-beta-glucosidase ... 55 8e-06 >emb|CBI28862.3| unnamed protein product [Vitis vinifera] Length = 355 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 2 QKKNRAIGTCDFGGAAYVVTQAPKFGKCQLSPG 100 QKK R IGTCDF GAAYVVTQAP+FGKC+ G Sbjct: 322 QKKGRVIGTCDFQGAAYVVTQAPRFGKCEFPTG 354 >ref|XP_002274828.1| PREDICTED: glucan endo-1,3-beta-glucosidase 3-like [Vitis vinifera] Length = 471 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 2 QKKNRAIGTCDFGGAAYVVTQAPKFGKCQLSPG 100 QKK R IGTCDF GAAYVVTQAP+FGKC+ G Sbjct: 438 QKKGRVIGTCDFQGAAYVVTQAPRFGKCEFPTG 470 >ref|XP_003573030.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Brachypodium distachyon] Length = 522 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 2 QKKNRAIGTCDFGGAAYVVTQAPKFGKCQL 91 Q+K R+IGTCDF GAAYVV QAPK GKC+L Sbjct: 489 QRKGRSIGTCDFAGAAYVVNQAPKMGKCEL 518