BLASTX nr result
ID: Coptis23_contig00021219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00021219 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004162217.1| PREDICTED: uncharacterized protein LOC101227... 55 5e-06 ref|XP_004134498.1| PREDICTED: uncharacterized protein LOC101213... 55 5e-06 ref|XP_002519182.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_004162217.1| PREDICTED: uncharacterized protein LOC101227580 [Cucumis sativus] Length = 269 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = +3 Query: 249 MPVTHADLAPGRRTSDLGSKWGAFLMALSILCGLCCF 359 M VTH DL P ++S+LGSK G FL+ L+ILCGLCCF Sbjct: 1 MAVTHDDLLPSPKSSELGSKMGTFLIILTILCGLCCF 37 >ref|XP_004134498.1| PREDICTED: uncharacterized protein LOC101213882 [Cucumis sativus] Length = 276 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = +3 Query: 249 MPVTHADLAPGRRTSDLGSKWGAFLMALSILCGLCCF 359 M VTH DL P ++S+LGSK G FL+ L+ILCGLCCF Sbjct: 8 MAVTHDDLLPSPKSSELGSKMGTFLIILTILCGLCCF 44 >ref|XP_002519182.1| conserved hypothetical protein [Ricinus communis] gi|223541497|gb|EEF43046.1| conserved hypothetical protein [Ricinus communis] Length = 264 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = +3 Query: 252 PVTHADLAPGRRTSDLGSKWGAFLMALSILCGLCCF 359 P+THADLAPG R++DLGSK AFL L+I CG CF Sbjct: 4 PITHADLAPGPRSTDLGSKTAAFLTVLTIFCGFFCF 39