BLASTX nr result
ID: Coptis23_contig00021194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00021194 (213 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAR13301.1| anthocyanin acyltransferase [Phaseolus vulgaris] 55 8e-06 >gb|AAR13301.1| anthocyanin acyltransferase [Phaseolus vulgaris] Length = 467 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = +3 Query: 87 TVDVLEQCQISPPFGSVPKTSLPLTFFDIVWL 182 T+ V+EQC++SPP GSVP TS+PLTFFD+ WL Sbjct: 4 TLKVIEQCEVSPPPGSVPSTSIPLTFFDLPWL 35