BLASTX nr result
ID: Coptis23_contig00021079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00021079 (1385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324476.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-06 ref|XP_004167072.1| PREDICTED: pentatricopeptide repeat-containi... 57 9e-06 ref|XP_004147297.1| PREDICTED: pentatricopeptide repeat-containi... 57 9e-06 >ref|XP_002324476.1| predicted protein [Populus trichocarpa] gi|222865910|gb|EEF03041.1| predicted protein [Populus trichocarpa] Length = 440 Score = 59.7 bits (143), Expect = 2e-06 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 1385 RQGKIGEAIRLLKEFQEKDLVDGFTYNKLLYVIEDEF 1275 RQG+IGEA LLKE+QEKDLVDG TY +LL+V+ED+F Sbjct: 393 RQGRIGEATSLLKEWQEKDLVDGITYRELLHVLEDDF 429 >ref|XP_004167072.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Cucumis sativus] Length = 428 Score = 57.4 bits (137), Expect = 9e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -1 Query: 1385 RQGKIGEAIRLLKEFQEKDLVDGFTYNKLLYVIEDEF 1275 RQGK+ EA LL+E QEKDLVDG TY KLLYV+ED++ Sbjct: 388 RQGKVVEATSLLRELQEKDLVDGHTYRKLLYVLEDDY 424 >ref|XP_004147297.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Cucumis sativus] Length = 428 Score = 57.4 bits (137), Expect = 9e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -1 Query: 1385 RQGKIGEAIRLLKEFQEKDLVDGFTYNKLLYVIEDEF 1275 RQGK+ EA LL+E QEKDLVDG TY KLLYV+ED++ Sbjct: 388 RQGKVVEATSLLRELQEKDLVDGHTYRKLLYVLEDDY 424