BLASTX nr result
ID: Coptis23_contig00021015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00021015 (460 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510334.1| pentatricopeptide repeat-containing protein,... 102 1e-25 emb|CAN66818.1| hypothetical protein VITISV_004776 [Vitis vinifera] 92 1e-19 ref|XP_002281859.2| PREDICTED: putative pentatricopeptide repeat... 92 1e-19 ref|NP_173362.2| pentatricopeptide repeat-containing protein [Ar... 95 5e-18 ref|XP_002890327.1| pentatricopeptide repeat-containing protein ... 94 1e-17 >ref|XP_002510334.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223551035|gb|EEF52521.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 947 Score = 102 bits (255), Expect(2) = 1e-25 Identities = 49/79 (62%), Positives = 62/79 (78%) Frame = -3 Query: 239 LVLERYHAINELYLDYSDDIIEGALQKLKFNPIACLPIFQLALKQQNFRPNVLAYCKMVH 60 LVL RYHA+ +L +SD I++ L KLKFNPIA L F+LA KQ NFRPNV ++CK+VH Sbjct: 43 LVLGRYHALKDLNFQFSDYILDSVLLKLKFNPIASLHFFKLASKQSNFRPNVNSHCKLVH 102 Query: 59 ILAKARMFDEAKWYLNELV 3 IL++ARM+DE + YLNELV Sbjct: 103 ILSRARMYDETRSYLNELV 121 Score = 38.5 bits (88), Expect(2) = 1e-25 Identities = 22/52 (42%), Positives = 30/52 (57%) Frame = -2 Query: 393 MIRYIPISRYNFHSINQKHSFHTTPTLHLQWKQRHEYKLQKPELINRICRIL 238 M+RY PI + + + S+H WK RHE KL +PELI+RI R+L Sbjct: 1 MLRYSPIFP-SLSLLRLRKSYH--------WKPRHESKLTRPELIDRISRLL 43 >emb|CAN66818.1| hypothetical protein VITISV_004776 [Vitis vinifera] Length = 1037 Score = 92.4 bits (228), Expect(2) = 1e-19 Identities = 42/79 (53%), Positives = 59/79 (74%) Frame = -3 Query: 239 LVLERYHAINELYLDYSDDIIEGALQKLKFNPIACLPIFQLALKQQNFRPNVLAYCKMVH 60 ++L R +AI++L +SDDI++ L+ L+ NP A L FQ KQQNFRPNV +YCK+VH Sbjct: 51 VLLRRCNAISKLNFVFSDDIVDAVLRNLRLNPTASLGFFQFVSKQQNFRPNVKSYCKLVH 110 Query: 59 ILAKARMFDEAKWYLNELV 3 IL++ RM+DE + YLN+LV Sbjct: 111 ILSRGRMYDETRAYLNQLV 129 Score = 28.9 bits (63), Expect(2) = 1e-19 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 309 LQWKQRHEYKLQKPELINRICRIL 238 L WK R E PEL++RICR++ Sbjct: 28 LLWKLRDESHPAPPELVSRICRLV 51 >ref|XP_002281859.2| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like [Vitis vinifera] Length = 939 Score = 92.4 bits (228), Expect(2) = 1e-19 Identities = 42/79 (53%), Positives = 59/79 (74%) Frame = -3 Query: 239 LVLERYHAINELYLDYSDDIIEGALQKLKFNPIACLPIFQLALKQQNFRPNVLAYCKMVH 60 ++L R +AI++L +SDDI++ L+ L+ NP A L FQ KQQNFRPNV +YCK+VH Sbjct: 51 VLLRRCNAISKLNFVFSDDIVDAVLRNLRLNPTASLGFFQFVSKQQNFRPNVKSYCKLVH 110 Query: 59 ILAKARMFDEAKWYLNELV 3 IL++ RM+DE + YLN+LV Sbjct: 111 ILSRGRMYDETRAYLNQLV 129 Score = 28.9 bits (63), Expect(2) = 1e-19 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 309 LQWKQRHEYKLQKPELINRICRIL 238 L WK R E PEL++RICR++ Sbjct: 28 LLWKLRDESHPAPPELVSRICRLV 51 >ref|NP_173362.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806505|sp|Q9LN69.2|PPR50_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At1g19290 gi|332191705|gb|AEE29826.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 904 Score = 95.1 bits (235), Expect = 5e-18 Identities = 45/79 (56%), Positives = 60/79 (75%) Frame = -3 Query: 239 LVLERYHAINELYLDYSDDIIEGALQKLKFNPIACLPIFQLALKQQNFRPNVLAYCKMVH 60 LVL RY A+++L LD+SD+++ L++L+ NP ACL IF LA KQQ FRP+ AYCKMVH Sbjct: 53 LVLGRYEALHDLSLDFSDELLNSILRRLRLNPEACLEIFNLASKQQKFRPDYKAYCKMVH 112 Query: 59 ILAKARMFDEAKWYLNELV 3 IL++AR + + K YL ELV Sbjct: 113 ILSRARNYQQTKSYLCELV 131 >ref|XP_002890327.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336169|gb|EFH66586.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 903 Score = 93.6 bits (231), Expect = 1e-17 Identities = 44/79 (55%), Positives = 60/79 (75%) Frame = -3 Query: 239 LVLERYHAINELYLDYSDDIIEGALQKLKFNPIACLPIFQLALKQQNFRPNVLAYCKMVH 60 LVL RY A+++L LD+SD+++ L++L+ NP AC+ IF LA KQQ FRP+ AYCKMVH Sbjct: 53 LVLGRYEALHDLSLDFSDELLNSILRRLRLNPEACVEIFNLASKQQKFRPDYKAYCKMVH 112 Query: 59 ILAKARMFDEAKWYLNELV 3 IL++AR + + K YL ELV Sbjct: 113 ILSRARNYGQTKSYLCELV 131