BLASTX nr result
ID: Coptis23_contig00020464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00020464 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283273.1| PREDICTED: ATP-dependent zinc metalloproteas... 55 6e-06 >ref|XP_002283273.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Vitis vinifera] gi|297746048|emb|CBI16104.3| unnamed protein product [Vitis vinifera] Length = 820 Score = 55.1 bits (131), Expect = 6e-06 Identities = 34/72 (47%), Positives = 45/72 (62%), Gaps = 3/72 (4%) Frame = -3 Query: 211 MIFSRMGRSLSQSERRRFIKNCLLSGYGGKPSSINDTLLRSPLV---YGDLSGGLISLRG 41 MI SR+GRSLS+S + +N L G G+ + +N+ L R+P G L GGL LRG Sbjct: 1 MILSRLGRSLSRSSTAK-PRNVLSGGNVGRSAFLNEALSRAPHYSTDLGQLDGGLGFLRG 59 Query: 40 YLTFIGANKGLV 5 YLT IGA++G V Sbjct: 60 YLTSIGASRGFV 71