BLASTX nr result
ID: Coptis23_contig00020433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00020433 (622 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279594.1| PREDICTED: sodium-dependent phosphate transp... 73 4e-11 ref|XP_004164590.1| PREDICTED: sodium-dependent phosphate transp... 73 5e-11 ref|XP_004151590.1| PREDICTED: probable anion transporter 1, chl... 73 5e-11 ref|XP_002313389.1| predicted protein [Populus trichocarpa] gi|2... 73 5e-11 ref|XP_002298320.1| predicted protein [Populus trichocarpa] gi|2... 73 5e-11 >ref|XP_002279594.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic [Vitis vinifera] gi|297745933|emb|CBI15989.3| unnamed protein product [Vitis vinifera] Length = 514 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 HGSWDDVFKVSVGLYLVGTVIWNLFSTGEKILD 100 HGSWDDVFKVSVGLYLVGTVIWNLFSTGEKILD Sbjct: 482 HGSWDDVFKVSVGLYLVGTVIWNLFSTGEKILD 514 >ref|XP_004164590.1| PREDICTED: sodium-dependent phosphate transport protein 1, chloroplastic-like [Cucumis sativus] Length = 528 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 2 HGSWDDVFKVSVGLYLVGTVIWNLFSTGEKILD 100 HGSWDDVFKVSVGLYLVGTV+WNLFSTGEKILD Sbjct: 496 HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD 528 >ref|XP_004151590.1| PREDICTED: probable anion transporter 1, chloroplastic-like, partial [Cucumis sativus] Length = 356 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 2 HGSWDDVFKVSVGLYLVGTVIWNLFSTGEKILD 100 HGSWDDVFKVSVGLYLVGTV+WNLFSTGEKILD Sbjct: 324 HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD 356 >ref|XP_002313389.1| predicted protein [Populus trichocarpa] gi|222849797|gb|EEE87344.1| predicted protein [Populus trichocarpa] Length = 520 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 2 HGSWDDVFKVSVGLYLVGTVIWNLFSTGEKILD 100 HGSWDDVFKVSVGLYLVGTV+WNLFSTGEKILD Sbjct: 488 HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD 520 >ref|XP_002298320.1| predicted protein [Populus trichocarpa] gi|222845578|gb|EEE83125.1| predicted protein [Populus trichocarpa] Length = 431 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 2 HGSWDDVFKVSVGLYLVGTVIWNLFSTGEKILD 100 HGSWDDVFKVSVGLYLVGTV+WNLFSTGEKILD Sbjct: 399 HGSWDDVFKVSVGLYLVGTVVWNLFSTGEKILD 431