BLASTX nr result
ID: Coptis23_contig00020406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00020406 (421 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524662.1| heat shock protein binding protein, putative... 55 8e-06 >ref|XP_002524662.1| heat shock protein binding protein, putative [Ricinus communis] gi|223536023|gb|EEF37681.1| heat shock protein binding protein, putative [Ricinus communis] Length = 301 Score = 54.7 bits (130), Expect = 8e-06 Identities = 38/100 (38%), Positives = 45/100 (45%), Gaps = 1/100 (1%) Frame = -2 Query: 297 ISATITSPAQPFLKPKSTLPQQYIYPKKASFRWRHNSXXXXXXXXXXXXXXXXXXXXXVV 118 +S +I S PF PK + P RWR Sbjct: 4 MSLSIVSVYYPFSLPKLSQFHGCFNPNNTCSRWRQKCPR--------------------- 42 Query: 117 IRCC-RSTANGVKTENYYELLGVSFESNPKAIKEAYRKLQ 1 IRCC R TA+ +NYYELLGVS +S+ K IKEAYRKLQ Sbjct: 43 IRCCIRQTASTRTDKNYYELLGVSVDSDVKGIKEAYRKLQ 82