BLASTX nr result
ID: Coptis23_contig00020223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00020223 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615650.1| NBS-LRR resistance protein [Medicago truncat... 56 3e-06 ref|XP_003615706.1| NBS-LRR resistance protein [Medicago truncat... 56 3e-06 ref|XP_002532127.1| leucine-rich repeat containing protein, puta... 56 3e-06 >ref|XP_003615650.1| NBS-LRR resistance protein [Medicago truncatula] gi|355516985|gb|AES98608.1| NBS-LRR resistance protein [Medicago truncatula] Length = 1169 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/51 (50%), Positives = 40/51 (78%) Frame = -1 Query: 153 MAHAVISVVLEQLRSILQTEVNLLAGVRKESEKLADTLTLIRGVLEDAEEK 1 MA+A++ VV E L S+LQ E + ++G++ ++EKL+ TL LI+ VLEDAE+K Sbjct: 1 MANALLGVVFENLMSLLQNEFSTISGIKSKAEKLSTTLDLIKAVLEDAEKK 51 >ref|XP_003615706.1| NBS-LRR resistance protein [Medicago truncatula] gi|355517041|gb|AES98664.1| NBS-LRR resistance protein [Medicago truncatula] Length = 1327 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/51 (49%), Positives = 40/51 (78%) Frame = -1 Query: 153 MAHAVISVVLEQLRSILQTEVNLLAGVRKESEKLADTLTLIRGVLEDAEEK 1 MA A+I VV + L+S+LQ E ++G++ +++KL+DTL +I+ VLEDAE+K Sbjct: 1 MADALIGVVFDNLKSLLQNEFATISGIKSKAQKLSDTLDMIKAVLEDAEKK 51 >ref|XP_002532127.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223528186|gb|EEF30247.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 1142 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = -1 Query: 153 MAHAVISVVLEQLRSILQTEVNLLAGVRKESEKLADTLTLIRGVLEDAEEK 1 MA A + +VLE L S++Q EV LL G+ KE E L+ L+ I+ VLEDAEEK Sbjct: 1 MAEAFLQIVLENLDSLIQNEVGLLLGIDKEMESLSSILSTIQAVLEDAEEK 51