BLASTX nr result
ID: Coptis23_contig00020156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00020156 (669 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001057165.1| Os06g0219800 [Oryza sativa Japonica Group] g... 61 2e-07 gb|AFW85282.1| serine/threonine-protein phosphatase 2A activator... 61 2e-07 ref|XP_003564074.1| PREDICTED: serine/threonine-protein phosphat... 61 2e-07 dbj|BAJ99141.1| predicted protein [Hordeum vulgare subsp. vulgare] 61 2e-07 ref|XP_002438070.1| hypothetical protein SORBIDRAFT_10g007650 [S... 61 2e-07 >ref|NP_001057165.1| Os06g0219800 [Oryza sativa Japonica Group] gi|51535369|dbj|BAD37240.1| putative phosphotyrosyl phosphatase activator [Oryza sativa Japonica Group] gi|113595205|dbj|BAF19079.1| Os06g0219800 [Oryza sativa Japonica Group] Length = 396 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 669 VNGGLLKMYKAEVLGKVPIMQHFLFGSLINWD 574 VN GLLKMYKAEVL KVPIMQHFLFGSLI W+ Sbjct: 364 VNSGLLKMYKAEVLEKVPIMQHFLFGSLIKWE 395 >gb|AFW85282.1| serine/threonine-protein phosphatase 2A activator 2 [Zea mays] Length = 387 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 669 VNGGLLKMYKAEVLGKVPIMQHFLFGSLINWD 574 VN GLLKMYKAEVL KVPIMQHFLFGSLI W+ Sbjct: 355 VNSGLLKMYKAEVLEKVPIMQHFLFGSLIKWE 386 >ref|XP_003564074.1| PREDICTED: serine/threonine-protein phosphatase 2A activator-like [Brachypodium distachyon] Length = 392 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 669 VNGGLLKMYKAEVLGKVPIMQHFLFGSLINWD 574 VN GLLKMYKAEVL KVPIMQHFLFGSLI W+ Sbjct: 360 VNSGLLKMYKAEVLEKVPIMQHFLFGSLIKWE 391 >dbj|BAJ99141.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 395 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 669 VNGGLLKMYKAEVLGKVPIMQHFLFGSLINWD 574 VN GLLKMYKAEVL KVPIMQHFLFGSLI W+ Sbjct: 363 VNSGLLKMYKAEVLEKVPIMQHFLFGSLIKWE 394 >ref|XP_002438070.1| hypothetical protein SORBIDRAFT_10g007650 [Sorghum bicolor] gi|241916293|gb|EER89437.1| hypothetical protein SORBIDRAFT_10g007650 [Sorghum bicolor] Length = 387 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 669 VNGGLLKMYKAEVLGKVPIMQHFLFGSLINWD 574 VN GLLKMYKAEVL KVPIMQHFLFGSLI W+ Sbjct: 355 VNSGLLKMYKAEVLEKVPIMQHFLFGSLIKWE 386