BLASTX nr result
ID: Coptis23_contig00019883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00019883 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264585.2| PREDICTED: calcium-transporting ATPase, endo... 161 6e-38 emb|CBI40589.3| unnamed protein product [Vitis vinifera] 161 6e-38 emb|CAN66975.1| hypothetical protein VITISV_022077 [Vitis vinifera] 161 6e-38 ref|XP_002320213.1| endoplasmic reticulum [ER]-type calcium ATPa... 157 8e-37 ref|XP_002523297.1| calcium-transporting atpase 4, endoplasmic r... 150 1e-34 >ref|XP_002264585.2| PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type-like [Vitis vinifera] Length = 1051 Score = 161 bits (407), Expect = 6e-38 Identities = 77/91 (84%), Positives = 86/91 (94%) Frame = -1 Query: 273 VRKSMSVIVREPTGNNRLLVKGAIESLLERSSHVQLADGSIVPIDEPCRQL*ILRNLEMS 94 +RKSMSV+VREPTG NRLLVKGA+ESLLERSSHVQLADGS+VP+DEP RQL +LRNLEMS Sbjct: 510 IRKSMSVLVREPTGRNRLLVKGAVESLLERSSHVQLADGSLVPLDEPYRQLLLLRNLEMS 569 Query: 93 SKGLRCLALAYKDDVGEFSDYYSECHPSHKK 1 SKGLRCL LAYKDD+GEFSDYY+E HP+HKK Sbjct: 570 SKGLRCLGLAYKDDLGEFSDYYTETHPAHKK 600 >emb|CBI40589.3| unnamed protein product [Vitis vinifera] Length = 778 Score = 161 bits (407), Expect = 6e-38 Identities = 77/91 (84%), Positives = 86/91 (94%) Frame = -1 Query: 273 VRKSMSVIVREPTGNNRLLVKGAIESLLERSSHVQLADGSIVPIDEPCRQL*ILRNLEMS 94 +RKSMSV+VREPTG NRLLVKGA+ESLLERSSHVQLADGS+VP+DEP RQL +LRNLEMS Sbjct: 291 IRKSMSVLVREPTGRNRLLVKGAVESLLERSSHVQLADGSLVPLDEPYRQLLLLRNLEMS 350 Query: 93 SKGLRCLALAYKDDVGEFSDYYSECHPSHKK 1 SKGLRCL LAYKDD+GEFSDYY+E HP+HKK Sbjct: 351 SKGLRCLGLAYKDDLGEFSDYYTETHPAHKK 381 >emb|CAN66975.1| hypothetical protein VITISV_022077 [Vitis vinifera] Length = 1051 Score = 161 bits (407), Expect = 6e-38 Identities = 77/91 (84%), Positives = 86/91 (94%) Frame = -1 Query: 273 VRKSMSVIVREPTGNNRLLVKGAIESLLERSSHVQLADGSIVPIDEPCRQL*ILRNLEMS 94 +RKSMSV+VREPTG NRLLVKGA+ESLLERSSHVQLADGS+VP+DEP RQL +LRNLEMS Sbjct: 510 IRKSMSVLVREPTGRNRLLVKGAVESLLERSSHVQLADGSLVPLDEPYRQLLLLRNLEMS 569 Query: 93 SKGLRCLALAYKDDVGEFSDYYSECHPSHKK 1 SKGLRCL LAYKDD+GEFSDYY+E HP+HKK Sbjct: 570 SKGLRCLGLAYKDDLGEFSDYYTETHPAHKK 600 >ref|XP_002320213.1| endoplasmic reticulum [ER]-type calcium ATPase [Populus trichocarpa] gi|222860986|gb|EEE98528.1| endoplasmic reticulum [ER]-type calcium ATPase [Populus trichocarpa] Length = 1045 Score = 157 bits (397), Expect = 8e-37 Identities = 76/91 (83%), Positives = 84/91 (92%) Frame = -1 Query: 273 VRKSMSVIVREPTGNNRLLVKGAIESLLERSSHVQLADGSIVPIDEPCRQL*ILRNLEMS 94 +RKSMS+IVREP G NRLLVKGA+ESLLERSSHVQLADGS+VPIDEPCRQL LR LEMS Sbjct: 504 IRKSMSIIVREPNGQNRLLVKGAVESLLERSSHVQLADGSVVPIDEPCRQLLSLRLLEMS 563 Query: 93 SKGLRCLALAYKDDVGEFSDYYSECHPSHKK 1 SKGLRCL LAYKDD+GEFSDY++E HP+HKK Sbjct: 564 SKGLRCLGLAYKDDLGEFSDYHAENHPAHKK 594 >ref|XP_002523297.1| calcium-transporting atpase 4, endoplasmic reticulum-type, putative [Ricinus communis] gi|223537385|gb|EEF39013.1| calcium-transporting atpase 4, endoplasmic reticulum-type, putative [Ricinus communis] Length = 591 Score = 150 bits (378), Expect = 1e-34 Identities = 70/91 (76%), Positives = 85/91 (93%) Frame = -1 Query: 273 VRKSMSVIVREPTGNNRLLVKGAIESLLERSSHVQLADGSIVPIDEPCRQL*ILRNLEMS 94 +RK+MSVIVREP G NRLLVKGA+ES++ERSS+VQLADGS++PIDEPCRQL +LR L+MS Sbjct: 51 IRKAMSVIVREPNGCNRLLVKGAVESIVERSSYVQLADGSLIPIDEPCRQLLLLRLLDMS 110 Query: 93 SKGLRCLALAYKDDVGEFSDYYSECHPSHKK 1 SKGLRCL LAYKD++GEFSDYY++ HP+HKK Sbjct: 111 SKGLRCLGLAYKDELGEFSDYYTDNHPAHKK 141