BLASTX nr result
ID: Coptis23_contig00019847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00019847 (366 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66134.1| hypothetical protein VITISV_006848 [Vitis vinifera] 65 4e-09 emb|CAN65018.1| hypothetical protein VITISV_018014 [Vitis vinifera] 65 4e-09 emb|CAN76505.1| hypothetical protein VITISV_016883 [Vitis vinifera] 65 4e-09 emb|CAN66945.1| hypothetical protein VITISV_020092 [Vitis vinifera] 65 4e-09 emb|CAN60433.1| hypothetical protein VITISV_020389 [Vitis vinifera] 65 6e-09 >emb|CAN66134.1| hypothetical protein VITISV_006848 [Vitis vinifera] Length = 626 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = -1 Query: 153 FEALSGLKANMTKTNLYEVGKADNLEELARIMGCGIGTLPCRYLGLPLGA 4 FEA+SGLK N+ K+ L VG N E+LAR++GC +G+LP YLGLPLGA Sbjct: 406 FEAISGLKINLHKSXLIPVGVVPNFEDLARVLGCKVGSLPSCYLGLPLGA 455 >emb|CAN65018.1| hypothetical protein VITISV_018014 [Vitis vinifera] Length = 805 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = -1 Query: 153 FEALSGLKANMTKTNLYEVGKADNLEELARIMGCGIGTLPCRYLGLPLGA 4 FEA+SGLK N+ K+ L VG N E+LAR++GC +G+LP YLGLPLGA Sbjct: 591 FEAISGLKINLHKSELIPVGVVPNFEDLARVLGCKVGSLPFCYLGLPLGA 640 >emb|CAN76505.1| hypothetical protein VITISV_016883 [Vitis vinifera] Length = 882 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = -1 Query: 153 FEALSGLKANMTKTNLYEVGKADNLEELARIMGCGIGTLPCRYLGLPLGA 4 FEA SGLK N++K+ + VG+ D++EELA +GC +G+LP +YLGLPLGA Sbjct: 249 FEAASGLKINLSKSEIIPVGEVDDIEELAAEVGCRVGSLPSQYLGLPLGA 298 >emb|CAN66945.1| hypothetical protein VITISV_020092 [Vitis vinifera] Length = 894 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = -1 Query: 153 FEALSGLKANMTKTNLYEVGKADNLEELARIMGCGIGTLPCRYLGLPLGA 4 FEA SGLK N++K+ + VG+ D++EELA +GC +G+LP +YLGLPLGA Sbjct: 629 FEAASGLKINLSKSEIIPVGEVDDIEELAAEVGCRVGSLPSQYLGLPLGA 678 >emb|CAN60433.1| hypothetical protein VITISV_020389 [Vitis vinifera] Length = 1463 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = -1 Query: 153 FEALSGLKANMTKTNLYEVGKADNLEELARIMGCGIGTLPCRYLGLPLGA 4 FEA+SGLK N+ K+ L VG+ N+ ELA ++GC +G LP YLGLPLGA Sbjct: 1306 FEAISGLKINLDKSELIPVGRVSNVVELASVIGCKVGVLPATYLGLPLGA 1355