BLASTX nr result
ID: Coptis23_contig00019759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00019759 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269769.1| PREDICTED: importin subunit beta-1 [Vitis vi... 65 7e-09 ref|XP_002323606.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 ref|XP_002309153.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 ref|XP_002440917.1| hypothetical protein SORBIDRAFT_09g016470 [S... 61 1e-07 ref|XP_002526656.1| importin beta-1, putative [Ricinus communis]... 60 1e-07 >ref|XP_002269769.1| PREDICTED: importin subunit beta-1 [Vitis vinifera] gi|297735635|emb|CBI18129.3| unnamed protein product [Vitis vinifera] Length = 872 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 96 YNALDFAQTNFENEMEQNYIMKVVCETAVSRE 1 YNALDFAQTNFENEME+NYIMKVVCETA+S+E Sbjct: 203 YNALDFAQTNFENEMERNYIMKVVCETAMSKE 234 >ref|XP_002323606.1| predicted protein [Populus trichocarpa] gi|222868236|gb|EEF05367.1| predicted protein [Populus trichocarpa] Length = 805 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 96 YNALDFAQTNFENEMEQNYIMKVVCETAVSRE 1 YNALDFAQTNFEN+ME+NYIMKVVCETA+S+E Sbjct: 203 YNALDFAQTNFENDMERNYIMKVVCETAISKE 234 >ref|XP_002309153.1| predicted protein [Populus trichocarpa] gi|222855129|gb|EEE92676.1| predicted protein [Populus trichocarpa] Length = 870 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 96 YNALDFAQTNFENEMEQNYIMKVVCETAVSRE 1 YNALDFAQTNF+NEME+NYIMKVVCETA+S+E Sbjct: 203 YNALDFAQTNFDNEMERNYIMKVVCETAISKE 234 >ref|XP_002440917.1| hypothetical protein SORBIDRAFT_09g016470 [Sorghum bicolor] gi|241946202|gb|EES19347.1| hypothetical protein SORBIDRAFT_09g016470 [Sorghum bicolor] Length = 870 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 96 YNALDFAQTNFENEMEQNYIMKVVCETAVSRE 1 YNALDFA++NF NEME+NYIMKVVCETAVS+E Sbjct: 201 YNALDFAESNFANEMERNYIMKVVCETAVSKE 232 >ref|XP_002526656.1| importin beta-1, putative [Ricinus communis] gi|223533956|gb|EEF35678.1| importin beta-1, putative [Ricinus communis] Length = 872 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -3 Query: 93 NALDFAQTNFENEMEQNYIMKVVCETAVSRE 1 NALDFAQ+NFENEME+NYIMKVVCETA+S+E Sbjct: 204 NALDFAQSNFENEMERNYIMKVVCETALSKE 234