BLASTX nr result
ID: Coptis23_contig00019654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00019654 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274136.2| PREDICTED: uncharacterized protein At1g76660... 50 1e-06 >ref|XP_002274136.2| PREDICTED: uncharacterized protein At1g76660-like [Vitis vinifera] Length = 484 Score = 49.7 bits (117), Expect(2) = 1e-06 Identities = 26/49 (53%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Frame = -3 Query: 239 PISGTSGDCLSSFFPEREFPAKW--AAXXXXXXXXXXXXSRLFGLDTGT 99 PIS TSGDCLSS FPEREFP +W + RLFGLDT + Sbjct: 208 PISRTSGDCLSSSFPEREFPPRWDPSISPQNAKYPRNGSGRLFGLDTAS 256 Score = 27.3 bits (59), Expect(2) = 1e-06 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 75 LSRDTTFFYPAASPQFHLDQARTS 4 +S+D+ FF PA QF+LD + S Sbjct: 259 ISQDSNFFCPATFAQFYLDHTQQS 282