BLASTX nr result
ID: Coptis23_contig00019613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00019613 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004168984.1| PREDICTED: pentatricopeptide repeat-containi... 65 8e-09 ref|XP_004146598.1| PREDICTED: pentatricopeptide repeat-containi... 65 8e-09 ref|XP_002531596.1| pentatricopeptide repeat-containing protein,... 62 4e-08 ref|XP_004168986.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_004146650.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 >ref|XP_004168984.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 461 Score = 64.7 bits (156), Expect = 8e-09 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = +3 Query: 210 NLFKRISSLGDQTVSVVPLLQQWVIEEEKSVTEDELNNFIKYLKARKRFKHALEI 374 NL++RIS +GD +SV PLL QWV+ E + V +DEL + IK L+ KRFKHALEI Sbjct: 30 NLYRRISPVGDPNISVTPLLDQWVL-EGRLVQQDELRHIIKELRVYKRFKHALEI 83 >ref|XP_004146598.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 227 Score = 64.7 bits (156), Expect = 8e-09 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = +3 Query: 210 NLFKRISSLGDQTVSVVPLLQQWVIEEEKSVTEDELNNFIKYLKARKRFKHALEI 374 NL++RIS +GD +SV PLL QWV+ E + V +DEL + IK L+ KRFKHALEI Sbjct: 30 NLYRRISPVGDPNISVTPLLDQWVL-EGRLVQQDELRHIIKELRVYKRFKHALEI 83 >ref|XP_002531596.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528792|gb|EEF30799.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 300 Score = 62.4 bits (150), Expect = 4e-08 Identities = 32/54 (59%), Positives = 41/54 (75%) Frame = +3 Query: 213 LFKRISSLGDQTVSVVPLLQQWVIEEEKSVTEDELNNFIKYLKARKRFKHALEI 374 L++RIS +GD VS+VP+L QW IEE KSV +D+L FIK L+ KR+ HALEI Sbjct: 51 LYRRISPVGDPKVSIVPILDQW-IEEGKSVNKDQLQVFIKELRYCKRYTHALEI 103 >ref|XP_004168986.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 191 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = +3 Query: 210 NLFKRISSLGDQTVSVVPLLQQWVIEEEKSVTEDELNNFIKYLKARKRFKHALEI 374 +L++RIS +GD +SV PLL QWV+ E V +DEL + IK L+ KRFKHALE+ Sbjct: 30 SLYRRISPVGDPNISVTPLLDQWVL-ESGLVQQDELRHIIKELRVYKRFKHALEV 83 >ref|XP_004146650.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 222 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = +3 Query: 210 NLFKRISSLGDQTVSVVPLLQQWVIEEEKSVTEDELNNFIKYLKARKRFKHALEI 374 +L++RIS +GD +SV PLL QWV+ E V +DEL + IK L+ KRFKHALE+ Sbjct: 30 SLYRRISPVGDPNISVTPLLDQWVL-ESGLVQQDELRHIIKELRVYKRFKHALEV 83