BLASTX nr result
ID: Coptis23_contig00018492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00018492 (223 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002328427.1| predicted protein [Populus trichocarpa] gi|2... 120 1e-25 ref|XP_002512344.1| excision repair cross-complementing 1 ercc1,... 117 8e-25 ref|XP_003574205.1| PREDICTED: DNA excision repair protein ERCC-... 116 2e-24 ref|XP_002281063.2| PREDICTED: DNA excision repair protein ERCC-... 116 2e-24 ref|NP_187172.1| DNA excision repair protein ERCC-1 [Arabidopsis... 114 6e-24 >ref|XP_002328427.1| predicted protein [Populus trichocarpa] gi|222838142|gb|EEE76507.1| predicted protein [Populus trichocarpa] Length = 382 Score = 120 bits (301), Expect = 1e-25 Identities = 57/67 (85%), Positives = 62/67 (92%) Frame = +2 Query: 20 LNHALTAVRRVNKTDVVTLGSNFGSLSRIMDSSMEDLARCPGIGEKKVKRLYDTFHEPFR 199 L+HALT VRRVNKTDVVTLGS FGSLS IMD+SMEDLARCPGIGE+KVKRLYDTFHEPF+ Sbjct: 231 LHHALTTVRRVNKTDVVTLGSTFGSLSNIMDASMEDLARCPGIGERKVKRLYDTFHEPFK 290 Query: 200 RAVTSQP 220 R V+S P Sbjct: 291 RVVSSHP 297 >ref|XP_002512344.1| excision repair cross-complementing 1 ercc1, putative [Ricinus communis] gi|223548305|gb|EEF49796.1| excision repair cross-complementing 1 ercc1, putative [Ricinus communis] Length = 392 Score = 117 bits (294), Expect = 8e-25 Identities = 55/67 (82%), Positives = 60/67 (89%) Frame = +2 Query: 20 LNHALTAVRRVNKTDVVTLGSNFGSLSRIMDSSMEDLARCPGIGEKKVKRLYDTFHEPFR 199 L HALT +R VNKTDVVTLGS FGSLS IMD+SMEDLARCPGIGE+KVKRLYDTFHEPF+ Sbjct: 237 LTHALTTIRHVNKTDVVTLGSTFGSLSNIMDASMEDLARCPGIGERKVKRLYDTFHEPFK 296 Query: 200 RAVTSQP 220 R V+S P Sbjct: 297 RVVSSHP 303 >ref|XP_003574205.1| PREDICTED: DNA excision repair protein ERCC-1-like [Brachypodium distachyon] Length = 391 Score = 116 bits (290), Expect = 2e-24 Identities = 56/67 (83%), Positives = 63/67 (94%) Frame = +2 Query: 20 LNHALTAVRRVNKTDVVTLGSNFGSLSRIMDSSMEDLARCPGIGEKKVKRLYDTFHEPFR 199 L HALT++RRVNKTDVVTLGS FGSLSRIMDSSME+LARCPGIGE+KVKR+YDTFHEPF+ Sbjct: 239 LTHALTSIRRVNKTDVVTLGSTFGSLSRIMDSSMEELARCPGIGERKVKRIYDTFHEPFK 298 Query: 200 RAVTSQP 220 R VT +P Sbjct: 299 R-VTPRP 304 >ref|XP_002281063.2| PREDICTED: DNA excision repair protein ERCC-1-like [Vitis vinifera] gi|296088298|emb|CBI36743.3| unnamed protein product [Vitis vinifera] Length = 398 Score = 116 bits (290), Expect = 2e-24 Identities = 56/67 (83%), Positives = 59/67 (88%) Frame = +2 Query: 20 LNHALTAVRRVNKTDVVTLGSNFGSLSRIMDSSMEDLARCPGIGEKKVKRLYDTFHEPFR 199 L HALT VR VNKTDVVTLGS FGSLS IMD+SMEDLARCPGIGE+KVKRLYDTFHEPF+ Sbjct: 242 LTHALTTVRHVNKTDVVTLGSTFGSLSHIMDASMEDLARCPGIGERKVKRLYDTFHEPFK 301 Query: 200 RAVTSQP 220 R V S P Sbjct: 302 RVVPSCP 308 >ref|NP_187172.1| DNA excision repair protein ERCC-1 [Arabidopsis thaliana] gi|55976606|sp|Q9MA98.1|ERCC1_ARATH RecName: Full=DNA excision repair protein ERCC-1; Short=AtERCC1; Short=AtRAD10; AltName: Full=Ultraviolet hypersensitive 7 gi|6729031|gb|AAF27027.1|AC009177_17 putative nucleotide repair protein [Arabidopsis thaliana] gi|9800490|gb|AAF99316.1|AF276082_1 ERCC1 [Arabidopsis thaliana] gi|15215614|gb|AAK91352.1| AT3g05210/T12H1_18 [Arabidopsis thaliana] gi|21435979|gb|AAM51569.1| AT3g05210/T12H1_18 [Arabidopsis thaliana] gi|21618171|gb|AAM67221.1| putative nucleotide repair protein [Arabidopsis thaliana] gi|332640684|gb|AEE74205.1| DNA excision repair protein ERCC-1 [Arabidopsis thaliana] Length = 410 Score = 114 bits (286), Expect = 6e-24 Identities = 52/67 (77%), Positives = 62/67 (92%) Frame = +2 Query: 20 LNHALTAVRRVNKTDVVTLGSNFGSLSRIMDSSMEDLARCPGIGEKKVKRLYDTFHEPFR 199 LNH+LT++R VNK+DVVTLGS FGSL+ I+D+SMEDLARCPGIGE+KVKRLYDTFHEPF+ Sbjct: 260 LNHSLTSIRHVNKSDVVTLGSTFGSLAHIIDASMEDLARCPGIGERKVKRLYDTFHEPFK 319 Query: 200 RAVTSQP 220 RA +S P Sbjct: 320 RATSSYP 326