BLASTX nr result
ID: Coptis23_contig00018409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00018409 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525699.1| PREDICTED: LOW QUALITY PROTEIN: argininosucc... 119 2e-25 ref|XP_003608852.1| Argininosuccinate synthase [Medicago truncat... 119 2e-25 ref|XP_003613940.1| Argininosuccinate synthase [Medicago truncat... 119 3e-25 ref|NP_001119047.1| argininosuccinate synthase [Arabidopsis thal... 118 4e-25 emb|CAB41123.1| argininosuccinate synthase-like protein [Arabido... 118 4e-25 >ref|XP_003525699.1| PREDICTED: LOW QUALITY PROTEIN: argininosuccinate synthase, chloroplastic-like [Glycine max] Length = 423 Score = 119 bits (299), Expect = 2e-25 Identities = 54/67 (80%), Positives = 65/67 (97%) Frame = +2 Query: 2 YVMTVDPEDAPDQPEYLEIGIQSGIPVSLNGIELSPATLLSQLNEIGGRHGIGRIDMVEN 181 Y+M+VDPEDAPDQPEY+EIGI+SG+PVS+NG LSPA+LL++LNEIGG+HGIGR+DMVEN Sbjct: 226 YIMSVDPEDAPDQPEYVEIGIESGLPVSVNGRRLSPASLLAELNEIGGKHGIGRVDMVEN 285 Query: 182 RLVGMKS 202 RLVGMKS Sbjct: 286 RLVGMKS 292 >ref|XP_003608852.1| Argininosuccinate synthase [Medicago truncatula] gi|355509907|gb|AES91049.1| Argininosuccinate synthase [Medicago truncatula] Length = 478 Score = 119 bits (299), Expect = 2e-25 Identities = 57/67 (85%), Positives = 64/67 (95%) Frame = +2 Query: 2 YVMTVDPEDAPDQPEYLEIGIQSGIPVSLNGIELSPATLLSQLNEIGGRHGIGRIDMVEN 181 Y+M+VDPEDAPDQ EYLEIGI+SG+PVSLNG LSPATLL++LNEIGG+HGIGRIDMVEN Sbjct: 281 YMMSVDPEDAPDQAEYLEIGIESGLPVSLNGKTLSPATLLAELNEIGGKHGIGRIDMVEN 340 Query: 182 RLVGMKS 202 RLVGMKS Sbjct: 341 RLVGMKS 347 >ref|XP_003613940.1| Argininosuccinate synthase [Medicago truncatula] gi|355515275|gb|AES96898.1| Argininosuccinate synthase [Medicago truncatula] Length = 480 Score = 119 bits (298), Expect = 3e-25 Identities = 57/67 (85%), Positives = 64/67 (95%) Frame = +2 Query: 2 YVMTVDPEDAPDQPEYLEIGIQSGIPVSLNGIELSPATLLSQLNEIGGRHGIGRIDMVEN 181 Y+M+VDPEDAPDQ EYLEIGI+SG+PVSLNG LSPA+LL++LNEIGGRHGIGRIDMVEN Sbjct: 283 YMMSVDPEDAPDQAEYLEIGIESGLPVSLNGKTLSPASLLAELNEIGGRHGIGRIDMVEN 342 Query: 182 RLVGMKS 202 RLVGMKS Sbjct: 343 RLVGMKS 349 >ref|NP_001119047.1| argininosuccinate synthase [Arabidopsis thaliana] gi|332659569|gb|AEE84969.1| argininosuccinate synthase [Arabidopsis thaliana] Length = 450 Score = 118 bits (296), Expect = 4e-25 Identities = 55/67 (82%), Positives = 64/67 (95%) Frame = +2 Query: 2 YVMTVDPEDAPDQPEYLEIGIQSGIPVSLNGIELSPATLLSQLNEIGGRHGIGRIDMVEN 181 Y+M+VDPEDAPDQPEY+EIGI+SG+PV+LNG LSPATLL++LN IGG+HGIGRIDMVEN Sbjct: 297 YMMSVDPEDAPDQPEYIEIGIESGLPVALNGKALSPATLLAELNTIGGKHGIGRIDMVEN 356 Query: 182 RLVGMKS 202 RLVGMKS Sbjct: 357 RLVGMKS 363 >emb|CAB41123.1| argininosuccinate synthase-like protein [Arabidopsis thaliana] gi|7269334|emb|CAB79393.1| argininosuccinate synthase-like protein [Arabidopsis thaliana] Length = 498 Score = 118 bits (296), Expect = 4e-25 Identities = 55/67 (82%), Positives = 64/67 (95%) Frame = +2 Query: 2 YVMTVDPEDAPDQPEYLEIGIQSGIPVSLNGIELSPATLLSQLNEIGGRHGIGRIDMVEN 181 Y+M+VDPEDAPDQPEY+EIGI+SG+PV+LNG LSPATLL++LN IGG+HGIGRIDMVEN Sbjct: 301 YMMSVDPEDAPDQPEYIEIGIESGLPVALNGKALSPATLLAELNTIGGKHGIGRIDMVEN 360 Query: 182 RLVGMKS 202 RLVGMKS Sbjct: 361 RLVGMKS 367