BLASTX nr result
ID: Coptis23_contig00018153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00018153 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271796.2| PREDICTED: cucumisin-like [Vitis vinifera] 64 1e-08 emb|CBI24380.3| unnamed protein product [Vitis vinifera] 64 1e-08 ref|XP_003535193.1| PREDICTED: cucumisin-like [Glycine max] 61 8e-08 ref|XP_004165285.1| PREDICTED: cucumisin-like, partial [Cucumis ... 58 9e-07 ref|XP_004153386.1| PREDICTED: cucumisin-like, partial [Cucumis ... 58 9e-07 >ref|XP_002271796.2| PREDICTED: cucumisin-like [Vitis vinifera] Length = 727 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 121 SGNQVTNVSFFRLAQGNARGAVPSARIAVYKVCWEEGCDA 2 +GN+V +VSFF LAQGNARG VPSARIAVYKVC E GC + Sbjct: 204 AGNKVEDVSFFELAQGNARGGVPSARIAVYKVCSEYGCQS 243 >emb|CBI24380.3| unnamed protein product [Vitis vinifera] Length = 760 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 121 SGNQVTNVSFFRLAQGNARGAVPSARIAVYKVCWEEGCDA 2 +GN+V +VSFF LAQGNARG VPSARIAVYKVC E GC + Sbjct: 175 AGNKVEDVSFFELAQGNARGGVPSARIAVYKVCSEYGCQS 214 >ref|XP_003535193.1| PREDICTED: cucumisin-like [Glycine max] Length = 690 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = -3 Query: 121 SGNQVTNVSFFRLAQGNARGAVPSARIAVYKVCWEEGCD 5 +GN V + SFF LA G ARG VPSARIAVYK CW GCD Sbjct: 163 AGNSVESTSFFGLASGTARGGVPSARIAVYKPCWSSGCD 201 >ref|XP_004165285.1| PREDICTED: cucumisin-like, partial [Cucumis sativus] Length = 795 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -3 Query: 118 GNQVTNVSFFRLAQGNARGAVPSARIAVYKVCWEEGC 8 GN V+N + F LA G +RG VPSARIAVYK+CW +GC Sbjct: 177 GNFVSNANLFGLAAGTSRGGVPSARIAVYKICWSDGC 213 >ref|XP_004153386.1| PREDICTED: cucumisin-like, partial [Cucumis sativus] Length = 401 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -3 Query: 118 GNQVTNVSFFRLAQGNARGAVPSARIAVYKVCWEEGC 8 GN V+N + F LA G +RG VPSARIAVYK+CW +GC Sbjct: 150 GNFVSNANLFGLAAGTSRGGVPSARIAVYKICWSDGC 186