BLASTX nr result
ID: Coptis23_contig00018138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00018138 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA57713.1| TPA: hypothetical protein ZEAMMB73_749382 [Zea m... 57 1e-06 ref|NP_001147292.1| glutamate carboxypeptidase 2 [Zea mays] gi|1... 57 1e-06 ref|XP_003633117.1| PREDICTED: probable glutamate carboxypeptida... 55 8e-06 ref|XP_002283565.2| PREDICTED: probable glutamate carboxypeptida... 55 8e-06 emb|CBI27988.3| unnamed protein product [Vitis vinifera] 55 8e-06 >tpg|DAA57713.1| TPA: hypothetical protein ZEAMMB73_749382 [Zea mays] Length = 442 Score = 57.4 bits (137), Expect = 1e-06 Identities = 22/37 (59%), Positives = 32/37 (86%) Frame = -1 Query: 248 ASIWGLVALQLADSEVLPFNYLTYAYELQVCTSNAID 138 AS+WGL+AL+LAD E++PFNY++YA EL+ CT + +D Sbjct: 268 ASVWGLIALKLADDEIIPFNYVSYASELEECTKDIVD 304 >ref|NP_001147292.1| glutamate carboxypeptidase 2 [Zea mays] gi|195609594|gb|ACG26627.1| glutamate carboxypeptidase 2 [Zea mays] gi|224029657|gb|ACN33904.1| unknown [Zea mays] gi|414880581|tpg|DAA57712.1| TPA: glutamate carboxypeptidase 2 [Zea mays] Length = 738 Score = 57.4 bits (137), Expect = 1e-06 Identities = 22/37 (59%), Positives = 32/37 (86%) Frame = -1 Query: 248 ASIWGLVALQLADSEVLPFNYLTYAYELQVCTSNAID 138 AS+WGL+AL+LAD E++PFNY++YA EL+ CT + +D Sbjct: 564 ASVWGLIALKLADDEIIPFNYVSYASELEECTKDIVD 600 >ref|XP_003633117.1| PREDICTED: probable glutamate carboxypeptidase 2-like isoform 2 [Vitis vinifera] Length = 689 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 251 AASIWGLVALQLADSEVLPFNYLTYAYELQ 162 AASIWGLVAL+LAD E LPF+YL+YAYELQ Sbjct: 513 AASIWGLVALRLADEEFLPFDYLSYAYELQ 542 >ref|XP_002283565.2| PREDICTED: probable glutamate carboxypeptidase 2-like isoform 1 [Vitis vinifera] Length = 704 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 251 AASIWGLVALQLADSEVLPFNYLTYAYELQ 162 AASIWGLVAL+LAD E LPF+YL+YAYELQ Sbjct: 528 AASIWGLVALRLADEEFLPFDYLSYAYELQ 557 >emb|CBI27988.3| unnamed protein product [Vitis vinifera] Length = 425 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 251 AASIWGLVALQLADSEVLPFNYLTYAYELQ 162 AASIWGLVAL+LAD E LPF+YL+YAYELQ Sbjct: 249 AASIWGLVALRLADEEFLPFDYLSYAYELQ 278