BLASTX nr result
ID: Coptis23_contig00018059
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00018059 (814 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281128.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vit... 53 2e-06 ref|XP_002279299.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vit... 50 4e-06 ref|XP_002276825.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vit... 50 4e-06 >ref|XP_002281128.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera] Length = 456 Score = 52.8 bits (125), Expect(2) = 2e-06 Identities = 24/53 (45%), Positives = 37/53 (69%) Frame = -1 Query: 715 DEKDTVKRSEIKTEVHELLGDEGIQSRAIKLRDMAKRSLSEAGMSSRTFKDLI 557 D + R EIK ++ +LL D+GI++ A+KL++MA+ S+SE G SS+ FK I Sbjct: 399 DGNGIISRHEIKIKIEKLLSDDGIKANALKLKEMARESVSEDGSSSKNFKAFI 451 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 809 EGVSIWIPLFCWSYLSD 759 EGVS+ +P CW +D Sbjct: 362 EGVSMGVPFLCWPQFAD 378 >ref|XP_002279299.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera] Length = 454 Score = 50.4 bits (119), Expect(2) = 4e-06 Identities = 23/54 (42%), Positives = 40/54 (74%) Frame = -1 Query: 718 KDEKDTVKRSEIKTEVHELLGDEGIQSRAIKLRDMAKRSLSEAGMSSRTFKDLI 557 +DE+ +++ EIK +V++LL DE I++RA+ L++MA S++E G S + FK+ I Sbjct: 396 RDERGIIQQGEIKNKVNQLLLDEKIKARAMVLKEMAMNSVTEGGNSHKNFKNFI 449 Score = 26.6 bits (57), Expect(2) = 4e-06 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 809 EGVSIWIPLFCWSYLSD 759 EGVS +P CW Y +D Sbjct: 360 EGVSNGVPFLCWPYFAD 376 >ref|XP_002276825.1| PREDICTED: UDP-glycosyltransferase 83A1 [Vitis vinifera] Length = 453 Score = 50.1 bits (118), Expect(2) = 4e-06 Identities = 24/53 (45%), Positives = 34/53 (64%) Frame = -1 Query: 715 DEKDTVKRSEIKTEVHELLGDEGIQSRAIKLRDMAKRSLSEAGMSSRTFKDLI 557 DE + R EIK +V +LLGDE +SRA+ L++MA S+ E G S FK+ + Sbjct: 396 DENGIITRKEIKNKVGQLLGDEKFRSRALNLKEMAIDSVKEGGPSHNNFKNFV 448 Score = 26.9 bits (58), Expect(2) = 4e-06 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 Query: 809 EGVSIWIPLFCWSYLSDLSDQFHKLIYI 726 EGVS +P CW Y +DQF YI Sbjct: 359 EGVSNGVPFLCWPY---FADQFVNETYI 383