BLASTX nr result
ID: Coptis23_contig00018053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00018053 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281862.2| PREDICTED: guanine nucleotide-binding protei... 62 4e-08 emb|CBI20732.3| unnamed protein product [Vitis vinifera] 58 7e-07 ref|XP_002516152.1| GTP-binding protein (p) alpha subunit, gpa1,... 58 9e-07 ref|XP_002324197.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 gb|ACF48819.1| G protein alpha subunit [Gossypium hirsutum] 56 3e-06 >ref|XP_002281862.2| PREDICTED: guanine nucleotide-binding protein alpha-1 subunit [Vitis vinifera] Length = 392 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +3 Query: 129 LLIQKMGSLCSKHHHYNEADLEENAQAAEIERRIAQE 239 ++I++MGS+CS+H HY+EAD EENAQAAEIERRI QE Sbjct: 4 IVIERMGSICSRHKHYHEADAEENAQAAEIERRIEQE 40 >emb|CBI20732.3| unnamed protein product [Vitis vinifera] Length = 384 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 144 MGSLCSKHHHYNEADLEENAQAAEIERRIAQE 239 MGS+CS+H HY+EAD EENAQAAEIERRI QE Sbjct: 1 MGSICSRHKHYHEADAEENAQAAEIERRIEQE 32 >ref|XP_002516152.1| GTP-binding protein (p) alpha subunit, gpa1, putative [Ricinus communis] gi|223544638|gb|EEF46154.1| GTP-binding protein (p) alpha subunit, gpa1, putative [Ricinus communis] Length = 392 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +3 Query: 132 LIQKMGSLCSKHHHYNEADLEENAQAAEIERRIAQE 239 ++ MGSLCSK YNEAD EENAQAAEIERRI QE Sbjct: 5 VVHNMGSLCSKQRRYNEADAEENAQAAEIERRIEQE 40 >ref|XP_002324197.1| predicted protein [Populus trichocarpa] gi|222865631|gb|EEF02762.1| predicted protein [Populus trichocarpa] Length = 384 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = +3 Query: 144 MGSLCSKHHHYNEADLEENAQAAEIERRIAQE 239 MG LCSK H YNEAD EENAQAAEIERRI QE Sbjct: 1 MGLLCSKRHRYNEADTEENAQAAEIERRIEQE 32 >gb|ACF48819.1| G protein alpha subunit [Gossypium hirsutum] Length = 392 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 132 LIQKMGSLCSKHHHYNEADLEENAQAAEIERRIAQE 239 +++ MG LCSK+H Y EAD EENAQAAEI+RRI QE Sbjct: 5 VLENMGLLCSKNHRYTEADAEENAQAAEIDRRIEQE 40