BLASTX nr result
ID: Coptis23_contig00017919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00017919 (554 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265664.2| PREDICTED: uncharacterized protein LOC100252... 65 7e-09 emb|CBI24554.3| unnamed protein product [Vitis vinifera] 65 7e-09 ref|XP_004143715.1| PREDICTED: uncharacterized protein LOC101210... 64 2e-08 ref|NP_201037.1| AGC (cAMP-dependent, cGMP-dependent and protein... 64 2e-08 ref|XP_002864783.1| hypothetical protein ARALYDRAFT_332465 [Arab... 64 2e-08 >ref|XP_002265664.2| PREDICTED: uncharacterized protein LOC100252544 [Vitis vinifera] Length = 1222 Score = 65.1 bits (157), Expect = 7e-09 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = +3 Query: 6 PNLAVKYSFSNFSFKNLSQLAFINYDLLVKTNMEPPNASKPSD 134 PNLAV YSFSNFSFKNLSQLA INYDLLVKT + P S+ S+ Sbjct: 1179 PNLAVNYSFSNFSFKNLSQLASINYDLLVKTFKDSPETSRSSN 1221 >emb|CBI24554.3| unnamed protein product [Vitis vinifera] Length = 1099 Score = 65.1 bits (157), Expect = 7e-09 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = +3 Query: 6 PNLAVKYSFSNFSFKNLSQLAFINYDLLVKTNMEPPNASKPSD 134 PNLAV YSFSNFSFKNLSQLA INYDLLVKT + P S+ S+ Sbjct: 1056 PNLAVNYSFSNFSFKNLSQLASINYDLLVKTFKDSPETSRSSN 1098 >ref|XP_004143715.1| PREDICTED: uncharacterized protein LOC101210442 [Cucumis sativus] gi|449488666|ref|XP_004158136.1| PREDICTED: uncharacterized LOC101210442 [Cucumis sativus] Length = 1179 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +3 Query: 12 LAVKYSFSNFSFKNLSQLAFINYDLLVKTNMEPPNASKPS 131 L+VKYSFSNFSFKNLSQLA INYDL+VK++ P+ SKPS Sbjct: 1138 LSVKYSFSNFSFKNLSQLASINYDLVVKSSQNSPDVSKPS 1177 >ref|NP_201037.1| AGC (cAMP-dependent, cGMP-dependent and protein kinase C) kinase family protein [Arabidopsis thaliana] gi|6729346|dbj|BAA89783.1| IRE [Arabidopsis thaliana] gi|8809644|dbj|BAA97195.1| IRE [Arabidopsis thaliana] gi|332010212|gb|AED97595.1| AGC (cAMP-dependent, cGMP-dependent and protein kinase C) kinase family protein [Arabidopsis thaliana] Length = 1168 Score = 63.5 bits (153), Expect = 2e-08 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = +3 Query: 3 GPNLAVKYSFSNFSFKNLSQLAFINYDLLVKTNMEPPNASKPS 131 GPNLAVKYSFSNFSFKNLSQLA INYDL++K E AS S Sbjct: 1120 GPNLAVKYSFSNFSFKNLSQLASINYDLVLKNAKESVEASNQS 1162 >ref|XP_002864783.1| hypothetical protein ARALYDRAFT_332465 [Arabidopsis lyrata subsp. lyrata] gi|297310618|gb|EFH41042.1| hypothetical protein ARALYDRAFT_332465 [Arabidopsis lyrata subsp. lyrata] Length = 1166 Score = 63.5 bits (153), Expect = 2e-08 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = +3 Query: 3 GPNLAVKYSFSNFSFKNLSQLAFINYDLLVKTNMEPPNASKPS 131 GPNLAVKYSFSNFSFKNLSQLA INYDL++K E AS S Sbjct: 1118 GPNLAVKYSFSNFSFKNLSQLASINYDLVLKNAKESVEASNQS 1160