BLASTX nr result
ID: Coptis23_contig00017837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00017837 (676 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABE87589.2| RNA-directed DNA polymerase (Reverse transcriptas... 57 4e-06 >gb|ABE87589.2| RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease H; Endonuclease/exonuclease/phosphatase [Medicago truncatula] Length = 1246 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/74 (37%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Frame = +2 Query: 404 GLVLRNYKGEFLGAAAGGMGIATNFLAETMAVVKAIKKALELGWRYILVECDSSSVVKAF 583 G + R+ G FLGA + +G+A+ F AET+A + A++ A GWR + +E DS+S + F Sbjct: 1039 GGLFRDSSGSFLGAFSCNIGLASVFHAETLAFILALEHAAHHGWRNLWLESDSTSALMIF 1098 Query: 584 QNNT-VHWRFKYQW 622 N++ V W + +W Sbjct: 1099 SNSSLVQWLLRNRW 1112