BLASTX nr result
ID: Coptis23_contig00017529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00017529 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003594097.1| Mitogen activated protein kinase 16-2 [Medic... 71 1e-10 ref|XP_002279719.2| PREDICTED: mitogen-activated protein kinase ... 71 1e-10 gb|AFP20219.1| MAP kinase [Nicotiana tabacum] 69 4e-10 ref|XP_003550513.1| PREDICTED: mitogen-activated protein kinase ... 69 4e-10 gb|AFK49469.1| unknown [Lotus japonicus] 67 2e-09 >ref|XP_003594097.1| Mitogen activated protein kinase 16-2 [Medicago truncatula] gi|355483145|gb|AES64348.1| Mitogen activated protein kinase 16-2 [Medicago truncatula] Length = 564 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/48 (72%), Positives = 42/48 (87%), Gaps = 1/48 (2%) Frame = +1 Query: 4 SYPRRNSSCKSER-EDEILDGSNGVQPKPQYLARKVAAAPQGVAGSQW 144 SYPRRN + KSER ED++++GSNG+QPKPQY+ARKVAAA QG AG QW Sbjct: 517 SYPRRNPNYKSERVEDDVIEGSNGLQPKPQYIARKVAAA-QGGAGGQW 563 >ref|XP_002279719.2| PREDICTED: mitogen-activated protein kinase 16-like [Vitis vinifera] gi|297736969|emb|CBI26170.3| unnamed protein product [Vitis vinifera] Length = 563 Score = 70.9 bits (172), Expect = 1e-10 Identities = 36/48 (75%), Positives = 42/48 (87%), Gaps = 1/48 (2%) Frame = +1 Query: 4 SYPRRNSSCKSERED-EILDGSNGVQPKPQYLARKVAAAPQGVAGSQW 144 SYPRRNSSCK+ER D E ++GSNG+QPKPQY+ARKVAAA QG +GS W Sbjct: 516 SYPRRNSSCKNERGDNEGVEGSNGLQPKPQYMARKVAAA-QGGSGSHW 562 >gb|AFP20219.1| MAP kinase [Nicotiana tabacum] Length = 566 Score = 68.9 bits (167), Expect = 4e-10 Identities = 35/48 (72%), Positives = 40/48 (83%), Gaps = 1/48 (2%) Frame = +1 Query: 4 SYPRRNSSCKSEREDEILDGSNGVQPKP-QYLARKVAAAPQGVAGSQW 144 SYPRR+ SCK+ER ++ DGSNGVQPKP QY+ARKVAAAP G GSQW Sbjct: 519 SYPRRHPSCKNERGEDSSDGSNGVQPKPEQYMARKVAAAPGG-PGSQW 565 >ref|XP_003550513.1| PREDICTED: mitogen-activated protein kinase 16-like [Glycine max] Length = 546 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = +1 Query: 1 NSYPRRNSSCKSEREDEILDGSNGVQPKPQYLARKVAAAPQGVAGSQW 144 +SYPRRN SCKSE+ +E ++G+NG+Q KPQY+ARKV AA QG G W Sbjct: 498 SSYPRRNPSCKSEKVEEGIEGANGLQTKPQYIARKVVAAAQGGPGGNW 545 >gb|AFK49469.1| unknown [Lotus japonicus] Length = 108 Score = 67.0 bits (162), Expect = 2e-09 Identities = 34/48 (70%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = +1 Query: 4 SYPRRNSSCKSER-EDEILDGSNGVQPKPQYLARKVAAAPQGVAGSQW 144 SYPRRN S K+ER +D+ ++GSNG+QPKPQY+ARKVAAA QG AG QW Sbjct: 61 SYPRRNPSYKNERPDDDGIEGSNGLQPKPQYMARKVAAA-QGGAGGQW 107