BLASTX nr result
ID: Coptis23_contig00017427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00017427 (369 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530914.1| beta-glucosidase, putative [Ricinus communis... 126 2e-27 ref|XP_003527305.1| PREDICTED: beta-glucosidase 25-like [Glycine... 123 1e-26 ref|XP_002319794.1| predicted protein [Populus trichocarpa] gi|2... 121 5e-26 ref|XP_002866052.1| glycosyl hydrolase family 1 protein [Arabido... 120 9e-26 ref|NP_200268.3| putative beta-glucosidase 41 [Arabidopsis thali... 119 2e-25 >ref|XP_002530914.1| beta-glucosidase, putative [Ricinus communis] gi|223529508|gb|EEF31463.1| beta-glucosidase, putative [Ricinus communis] Length = 495 Score = 126 bits (316), Expect = 2e-27 Identities = 55/66 (83%), Positives = 60/66 (90%) Frame = -1 Query: 369 NLSAAIRIDGCDVRGYFIWSLLDNWEWNSGYTVRFGLYYVDYRNNLTRIPKASVQWFKDV 190 NLSAAIR D CD+RGYF+WS+LDNWEWNSGYTVRFGLYYVDY+NNLTRIPKASVQWFK + Sbjct: 429 NLSAAIRQDKCDIRGYFVWSVLDNWEWNSGYTVRFGLYYVDYKNNLTRIPKASVQWFKSI 488 Query: 189 LR*TRD 172 LR D Sbjct: 489 LRLNSD 494 >ref|XP_003527305.1| PREDICTED: beta-glucosidase 25-like [Glycine max] Length = 507 Score = 123 bits (309), Expect = 1e-26 Identities = 54/62 (87%), Positives = 59/62 (95%) Frame = -1 Query: 369 NLSAAIRIDGCDVRGYFIWSLLDNWEWNSGYTVRFGLYYVDYRNNLTRIPKASVQWFKDV 190 NLSAAIR DGC+VRGYF+WSLLDNWEWN GYTVRFGLYYVD+RNNLTRIPK SVQWFK++ Sbjct: 438 NLSAAIREDGCNVRGYFVWSLLDNWEWNMGYTVRFGLYYVDFRNNLTRIPKDSVQWFKNM 497 Query: 189 LR 184 LR Sbjct: 498 LR 499 >ref|XP_002319794.1| predicted protein [Populus trichocarpa] gi|222858170|gb|EEE95717.1| predicted protein [Populus trichocarpa] Length = 515 Score = 121 bits (304), Expect = 5e-26 Identities = 55/72 (76%), Positives = 60/72 (83%) Frame = -1 Query: 369 NLSAAIRIDGCDVRGYFIWSLLDNWEWNSGYTVRFGLYYVDYRNNLTRIPKASVQWFKDV 190 N+SAAIR D CDVRGYF WSLLDNWEWNSGYTVRFGLY+VDYRNNLTR+PKAS +WFK Sbjct: 445 NISAAIRQDNCDVRGYFAWSLLDNWEWNSGYTVRFGLYFVDYRNNLTRVPKASAEWFKRT 504 Query: 189 LR*TRDNWSSNI 154 LR DN S + Sbjct: 505 LR-LEDNLQSQL 515 >ref|XP_002866052.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. lyrata] gi|297311887|gb|EFH42311.1| glycosyl hydrolase family 1 protein [Arabidopsis lyrata subsp. lyrata] Length = 529 Score = 120 bits (302), Expect = 9e-26 Identities = 53/72 (73%), Positives = 62/72 (86%) Frame = -1 Query: 369 NLSAAIRIDGCDVRGYFIWSLLDNWEWNSGYTVRFGLYYVDYRNNLTRIPKASVQWFKDV 190 NLSAAIR D CDVRGYF+WSLLDNWEWNSGYTVRFG+YYVDY+NNLTRIPKAS +WF+ + Sbjct: 444 NLSAAIRTDECDVRGYFVWSLLDNWEWNSGYTVRFGIYYVDYKNNLTRIPKASARWFQRI 503 Query: 189 LR*TRDNWSSNI 154 L + + SS + Sbjct: 504 LSGSTSSDSSKL 515 >ref|NP_200268.3| putative beta-glucosidase 41 [Arabidopsis thaliana] gi|281312219|sp|Q9FIU7.2|BGL41_ARATH RecName: Full=Putative beta-glucosidase 41; Short=AtBGLU41; Flags: Precursor gi|332009128|gb|AED96511.1| putative beta-glucosidase 41 [Arabidopsis thaliana] Length = 535 Score = 119 bits (299), Expect = 2e-25 Identities = 51/61 (83%), Positives = 57/61 (93%) Frame = -1 Query: 369 NLSAAIRIDGCDVRGYFIWSLLDNWEWNSGYTVRFGLYYVDYRNNLTRIPKASVQWFKDV 190 NLSAAIR D CDVRGYF+WSLLDNWEWNSGYTVRFG+YYVDY+NNLTRIPKAS +WF+ + Sbjct: 445 NLSAAIRNDECDVRGYFVWSLLDNWEWNSGYTVRFGIYYVDYKNNLTRIPKASARWFQTI 504 Query: 189 L 187 L Sbjct: 505 L 505