BLASTX nr result
ID: Coptis23_contig00017078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00017078 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF36296.1| hypothetical protein [Ipomoea trifida] 128 4e-28 ref|XP_003562090.1| PREDICTED: uncharacterized protein LOC100840... 127 7e-28 ref|XP_002879125.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyr... 127 7e-28 gb|AAS79576.1| putative CDK regulatory subunit [Ipomoea trifida] 127 7e-28 ref|NP_180363.1| cyclin-dependent kinases regulatory subunit 1 [... 127 1e-27 >dbj|BAF36296.1| hypothetical protein [Ipomoea trifida] Length = 1291 Score = 128 bits (322), Expect = 4e-28 Identities = 61/68 (89%), Positives = 65/68 (95%), Gaps = 1/68 (1%) Frame = -3 Query: 203 IHFTLIS-KMGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRG 27 + F +I+ +MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRG Sbjct: 1195 VSFRVIAVEMGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRG 1254 Query: 26 WVHYAIHR 3 WVHYAIHR Sbjct: 1255 WVHYAIHR 1262 >ref|XP_003562090.1| PREDICTED: uncharacterized protein LOC100840494 [Brachypodium distachyon] Length = 184 Score = 127 bits (320), Expect = 7e-28 Identities = 58/69 (84%), Positives = 64/69 (92%) Frame = -3 Query: 209 KAIHFTLISKMGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSR 30 K + L+ +MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLL+ENEWRA+GVQQSR Sbjct: 85 KRLDRELLVEMGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLAENEWRALGVQQSR 144 Query: 29 GWVHYAIHR 3 GWVHYA+HR Sbjct: 145 GWVHYAVHR 153 >ref|XP_002879125.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyrata] gi|297324964|gb|EFH55384.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyrata] Length = 87 Score = 127 bits (320), Expect = 7e-28 Identities = 59/59 (100%), Positives = 59/59 (100%) Frame = -3 Query: 179 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHR 3 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHR Sbjct: 1 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHR 59 >gb|AAS79576.1| putative CDK regulatory subunit [Ipomoea trifida] Length = 88 Score = 127 bits (320), Expect = 7e-28 Identities = 59/59 (100%), Positives = 59/59 (100%) Frame = -3 Query: 179 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHR 3 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHR Sbjct: 1 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHR 59 >ref|NP_180363.1| cyclin-dependent kinases regulatory subunit 1 [Arabidopsis thaliana] gi|75097781|sp|O23249.1|CKS1_ARATH RecName: Full=Cyclin-dependent kinases regulatory subunit 1; AltName: Full=CKS1-At gi|2274859|emb|CAA03859.1| Cks1 protein [Arabidopsis thaliana] gi|4510420|gb|AAD21506.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|21593913|gb|AAM65878.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51969580|dbj|BAD43482.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51969798|dbj|BAD43591.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51970380|dbj|BAD43882.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|88010880|gb|ABD38867.1| At2g27960 [Arabidopsis thaliana] gi|330252970|gb|AEC08064.1| cyclin-dependent kinases regulatory subunit 1 [Arabidopsis thaliana] Length = 87 Score = 127 bits (319), Expect = 1e-27 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -3 Query: 179 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHR 3 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYA+HR Sbjct: 1 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAVHR 59