BLASTX nr result
ID: Coptis23_contig00016933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00016933 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275111.2| PREDICTED: uncharacterized protein At2g33490... 64 1e-08 ref|XP_002512882.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 >ref|XP_002275111.2| PREDICTED: uncharacterized protein At2g33490-like [Vitis vinifera] Length = 700 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/54 (57%), Positives = 38/54 (70%) Frame = -2 Query: 208 AKGLHVAKLMEDSHYPVRTEGVASPPLTPLSLANVKPASTTFEVVAQSGQPKGE 47 A LHV K++E S P + E V SPPLTP+SL+N KP ST EV +QSGQ +GE Sbjct: 646 ATALHVTKVLESSQNPDKAEEVGSPPLTPISLSNSKPTSTISEVASQSGQIRGE 699 >ref|XP_002512882.1| conserved hypothetical protein [Ricinus communis] gi|223547893|gb|EEF49385.1| conserved hypothetical protein [Ricinus communis] Length = 656 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = -2 Query: 208 AKGLHVAKLMEDSHYPVRTEGVASPPLTPLSLANVKPASTTFEVVAQSGQPKG 50 A +HV+K +E P +TE V SPPLTP+SLAN+K AST E++ SGQ +G Sbjct: 600 AMTIHVSKSVESLQMPDKTEEVDSPPLTPISLANLKTASTISEIIPHSGQIRG 652