BLASTX nr result
ID: Coptis23_contig00016892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00016892 (578 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271803.2| PREDICTED: uncharacterized protein LOC100243... 56 5e-06 emb|CBI30815.3| unnamed protein product [Vitis vinifera] 56 5e-06 >ref|XP_002271803.2| PREDICTED: uncharacterized protein LOC100243465 [Vitis vinifera] Length = 1179 Score = 55.8 bits (133), Expect = 5e-06 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -2 Query: 538 SQPVAHPQVQGYQYPQQSNVQYGHMQGNQVFNPQMWHYYY 419 +QPV QV QYP QSN QYGHMQ +Q +N QMWHYYY Sbjct: 975 AQPVTQAQVS--QYPMQSNEQYGHMQNSQAYN-QMWHYYY 1011 >emb|CBI30815.3| unnamed protein product [Vitis vinifera] Length = 1195 Score = 55.8 bits (133), Expect = 5e-06 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -2 Query: 538 SQPVAHPQVQGYQYPQQSNVQYGHMQGNQVFNPQMWHYYY 419 +QPV QV QYP QSN QYGHMQ +Q +N QMWHYYY Sbjct: 930 AQPVTQAQVS--QYPMQSNEQYGHMQNSQAYN-QMWHYYY 966