BLASTX nr result
ID: Coptis23_contig00016867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00016867 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001238667.1| uncharacterized protein LOC100305658 [Glycin... 69 3e-10 gb|AFK40359.1| unknown [Medicago truncatula] 68 9e-10 ref|XP_003520934.1| PREDICTED: uncharacterized protein LOC100808... 67 2e-09 ref|XP_003564055.1| PREDICTED: uncharacterized protein LOC100835... 66 3e-09 ref|NP_200533.1| Thioredoxin-like domain-containing protein [Ara... 65 6e-09 >ref|NP_001238667.1| uncharacterized protein LOC100305658 [Glycine max] gi|255626219|gb|ACU13454.1| unknown [Glycine max] Length = 160 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 117 MGESTFFDRMISHVRATSKYYTGYPKDLGPSQVMHFASE 1 M + +FFDRMISH+RAT KYYTGYPKDLGPS+V+HF SE Sbjct: 1 MEDPSFFDRMISHLRATCKYYTGYPKDLGPSRVIHFTSE 39 >gb|AFK40359.1| unknown [Medicago truncatula] Length = 160 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 117 MGESTFFDRMISHVRATSKYYTGYPKDLGPSQVMHFASE 1 M +S+FF+RMI H+R T KYYTGYPKDLGPSQV+HF SE Sbjct: 1 MEDSSFFNRMIGHLRGTCKYYTGYPKDLGPSQVIHFTSE 39 >ref|XP_003520934.1| PREDICTED: uncharacterized protein LOC100808588 [Glycine max] Length = 160 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 117 MGESTFFDRMISHVRATSKYYTGYPKDLGPSQVMHFASE 1 M + +FFDRMISH+RAT +YTGYPKDLGPSQV+HF SE Sbjct: 1 MEDPSFFDRMISHLRATCMHYTGYPKDLGPSQVIHFTSE 39 >ref|XP_003564055.1| PREDICTED: uncharacterized protein LOC100835923 [Brachypodium distachyon] Length = 160 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 117 MGESTFFDRMISHVRATSKYYTGYPKDLGPSQVMHFASE 1 M E TFFDRM+S +R+TSKYYTGYPKDLGPS+++ F SE Sbjct: 1 MAEETFFDRMVSQLRSTSKYYTGYPKDLGPSRIIPFTSE 39 >ref|NP_200533.1| Thioredoxin-like domain-containing protein [Arabidopsis thaliana] gi|8777356|dbj|BAA96946.1| unnamed protein product [Arabidopsis thaliana] gi|124301042|gb|ABN04773.1| At5g57230 [Arabidopsis thaliana] gi|332009485|gb|AED96868.1| Thioredoxin-like domain-containing protein [Arabidopsis thaliana] Length = 160 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -3 Query: 117 MGESTFFDRMISHVRATSKYYTGYPKDLGPSQVMHFASE 1 MG+STF DRM+ +R+T KYY+GYPKDLGPS+V+HF SE Sbjct: 1 MGDSTFLDRMLLQLRSTCKYYSGYPKDLGPSRVLHFTSE 39