BLASTX nr result
ID: Coptis23_contig00016726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00016726 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71476.1| hypothetical protein VITISV_038619 [Vitis vinifera] 115 5e-24 ref|XP_002275052.2| PREDICTED: double-stranded RNA-binding prote... 112 3e-23 emb|CBI21312.3| unnamed protein product [Vitis vinifera] 112 3e-23 ref|XP_002298650.1| predicted protein [Populus trichocarpa] gi|2... 112 3e-23 ref|XP_002512890.1| double-stranded RNA binding protein, putativ... 112 4e-23 >emb|CAN71476.1| hypothetical protein VITISV_038619 [Vitis vinifera] Length = 552 Score = 115 bits (287), Expect = 5e-24 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = +3 Query: 141 SGFVGMYKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEVFEGPSYCTTL 314 +G V M+KNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGE+FE PSYCTTL Sbjct: 67 TGEVDMFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEIFESPSYCTTL 124 >ref|XP_002275052.2| PREDICTED: double-stranded RNA-binding protein 5 [Vitis vinifera] Length = 484 Score = 112 bits (280), Expect = 3e-23 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = +3 Query: 156 MYKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEVFEGPSYCTTL 314 M+KNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGE+FE PSYCTTL Sbjct: 4 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEIFESPSYCTTL 56 >emb|CBI21312.3| unnamed protein product [Vitis vinifera] Length = 481 Score = 112 bits (280), Expect = 3e-23 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = +3 Query: 156 MYKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEVFEGPSYCTTL 314 M+KNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGE+FE PSYCTTL Sbjct: 1 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEIFESPSYCTTL 53 >ref|XP_002298650.1| predicted protein [Populus trichocarpa] gi|222845908|gb|EEE83455.1| predicted protein [Populus trichocarpa] Length = 357 Score = 112 bits (280), Expect = 3e-23 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = +3 Query: 156 MYKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEVFEGPSYCTTL 314 M+KNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGE+FE PSYCTTL Sbjct: 1 MFKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEIFESPSYCTTL 53 >ref|XP_002512890.1| double-stranded RNA binding protein, putative [Ricinus communis] gi|223547901|gb|EEF49393.1| double-stranded RNA binding protein, putative [Ricinus communis] Length = 477 Score = 112 bits (279), Expect = 4e-23 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = +3 Query: 156 MYKNQLQELAQRSCFNLPSYACIREGPDHAPRFKASVNFNGEVFEGPSYCTTL 314 M+KNQLQELAQRSCFNLPSYAC+REGPDHAPRFKASVNFNGE+FE PSYCTTL Sbjct: 4 MFKNQLQELAQRSCFNLPSYACVREGPDHAPRFKASVNFNGEIFESPSYCTTL 56