BLASTX nr result
ID: Coptis23_contig00016722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00016722 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70078.1| hypothetical protein VITISV_001036 [Vitis vinifera] 60 2e-07 >emb|CAN70078.1| hypothetical protein VITISV_001036 [Vitis vinifera] Length = 773 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 3/81 (3%) Frame = +3 Query: 63 WFELPDMGWLTACAYNCVFVTLAPNQSLTYLPLR---TPPDFTFIISVARINNDIHYVPL 233 W +PDMG + A YN V V ++ LT+LPLR TP ++S+ I ND H+V + Sbjct: 658 WMTMPDMGHIIASRYNVVLVYISMQLCLTFLPLRSAPTPLPMRRVLSIGFI-NDNHFVEI 716 Query: 234 RLSDDAPLPPVISGYHNLAYP 296 ++ AP+PPV + + YP Sbjct: 717 LMTTGAPMPPVANSWSKSCYP 737