BLASTX nr result
ID: Coptis23_contig00016612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00016612 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 72 4e-11 ref|XP_002521818.1| conserved hypothetical protein [Ricinus comm... 63 3e-08 ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 50 2e-07 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 72.4 bits (176), Expect = 4e-11 Identities = 36/51 (70%), Positives = 37/51 (72%) Frame = +2 Query: 98 ARSKLRVGPCGLGEGLAYVVPRVEGTASVWFHRAAKTSRSRQWKDNESVAP 250 ARSKLRV PCGLGEG + PR EGTA WFHRAA TS S QWKDN V P Sbjct: 5 ARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPVLP 55 >ref|XP_002521818.1| conserved hypothetical protein [Ricinus communis] gi|223539031|gb|EEF40628.1| conserved hypothetical protein [Ricinus communis] Length = 78 Score = 62.8 bits (151), Expect = 3e-08 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = +3 Query: 96 LPVPS*ELALVD*AKAWPTWFLEWRVLRQSGFTEQRKPPALDSGRIT 236 LP PS EL+ V AK T LEWRVLR++GFTEQR PPALDSG IT Sbjct: 11 LPAPSGELSFVVLAKVGTTLLLEWRVLREAGFTEQRSPPALDSGWIT 57 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 50.4 bits (119), Expect(2) = 2e-07 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = -3 Query: 253 LWSNRLVILPLSRAGGFRCSVKPD*RSTLHSRNHVGQAFA*STRANS*LGTGKSVCSNPQ 74 L ++LVILPL RAGG RCSVKP R L SRN V AFA A G++ Q Sbjct: 14 LGRHQLVILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQGHIAQLSAWNGRARAQPHQ 73 Query: 73 ARP 65 RP Sbjct: 74 GRP 76 Score = 29.3 bits (64), Expect(2) = 2e-07 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -1 Query: 72 PDQKP*GPCSITLMPSLELQAHAT 1 P+Q+P ITLMP L LQAHAT Sbjct: 79 PEQRP-----ITLMPLLRLQAHAT 97