BLASTX nr result
ID: Coptis23_contig00016561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00016561 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26714.3| unnamed protein product [Vitis vinifera] 69 4e-10 ref|XP_002276902.1| PREDICTED: long-chain-alcohol O-fatty-acyltr... 69 4e-10 ref|NP_001240009.1| uncharacterized protein LOC100809798 [Glycin... 64 1e-08 ref|XP_003617668.1| hypothetical protein MTR_5g094140 [Medicago ... 62 5e-08 ref|XP_002532421.1| acyltransferase, putative [Ricinus communis]... 62 6e-08 >emb|CBI26714.3| unnamed protein product [Vitis vinifera] Length = 611 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/51 (58%), Positives = 41/51 (80%) Frame = +3 Query: 141 IKSLVKVWITVFASLNLCFFIVRKIPEGAFRLVFLLPIIFLFTVLPLNLSS 293 IKSL+KVWI+ +S+ C+F V ++P G FRL+FLLP+ +LF +LPLNLSS Sbjct: 5 IKSLIKVWISAISSICYCYFFVVRLPVGLFRLLFLLPMFYLFIILPLNLSS 55 >ref|XP_002276902.1| PREDICTED: long-chain-alcohol O-fatty-acyltransferase-like [Vitis vinifera] Length = 364 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/51 (58%), Positives = 41/51 (80%) Frame = +3 Query: 141 IKSLVKVWITVFASLNLCFFIVRKIPEGAFRLVFLLPIIFLFTVLPLNLSS 293 IKSL+KVWI+ +S+ C+F V ++P G FRL+FLLP+ +LF +LPLNLSS Sbjct: 5 IKSLIKVWISAISSICYCYFFVVRLPVGLFRLLFLLPMFYLFIILPLNLSS 55 >ref|NP_001240009.1| uncharacterized protein LOC100809798 [Glycine max] gi|255644493|gb|ACU22750.1| unknown [Glycine max] Length = 351 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/52 (51%), Positives = 41/52 (78%) Frame = +3 Query: 141 IKSLVKVWITVFASLNLCFFIVRKIPEGAFRLVFLLPIIFLFTVLPLNLSSV 296 IKSL+KVWI++ ASL C+FI ++P+G R + L P+++LFT+LPL L++V Sbjct: 13 IKSLMKVWISILASLCYCYFISSRVPKGLLRFLTLSPVLYLFTILPLQLTTV 64 >ref|XP_003617668.1| hypothetical protein MTR_5g094140 [Medicago truncatula] gi|355519003|gb|AET00627.1| hypothetical protein MTR_5g094140 [Medicago truncatula] Length = 454 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = +3 Query: 141 IKSLVKVWITVFASLNLCFFIVRKIPEGAFRLVFLLPIIFLFTVLPLNLSSV 296 IK+L+KVW+ V ASL+ C+FI IP+G R + L PI +LFT+LP LS V Sbjct: 13 IKNLIKVWLKVLASLSYCYFISSNIPKGILRFLSLSPIFYLFTILPFQLSLV 64 >ref|XP_002532421.1| acyltransferase, putative [Ricinus communis] gi|223527870|gb|EEF29962.1| acyltransferase, putative [Ricinus communis] Length = 369 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = +3 Query: 147 SLVKVWITVFASLNLCFFIVRKIPEGAFRLVFLLPIIFLFTVLPLNLSSV 296 + +K W+ +FASL+ CF + IP+G+ RL FLLPI+ LF +LPLN+SSV Sbjct: 7 NFIKAWLLIFASLSYCFATGKIIPKGSTRLFFLLPIVCLFLILPLNISSV 56